CAZyme Information: MGYG000001253_01682

Basic Information

• Species: Paramuribaculum sp001689535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp001689535
• CAZyme ID: MGYG000001253_01682
• CAZy Family: GT4
• CAZyme Description: Alpha-maltose-1-phosphate synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000001253_21|CGC1	40161.68	10.5286

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001253	2271514	MAG	Austria	Europe

• Gene Location: Start: 29448; End: 30542 Strand: +

Full Sequence      

MKRIKVYVTGTRGIPDIQGGVETHCRELYPRLQALGCDVTVARRKGYFADNSPRTYRGVT
LRDIAAPRIKGLEAFLHTFLAILDARRHNADVVHIHAIGPGIFVPLARLLGMRTVVTNHG
ADYRRPKWGAVARTILRLGERWSTRMSHAVIAISPGIAAELRQRYGRKEISVIANGVGVP
APVEDFGLIREMGLEPDGYILALGRLSREKGFHDLIEAYRQLEVPGMKLVIAGSAIPPTP
YSRQLHDLAHRAGAIMAGEVHGEKLRQLMGGAALFVLPSYHEGLSISLLEAMAAGRRIAL
SDIPANRLPGLHRDSFFPPGDPAAMARAMTATLTLPSPRTYDLTPYEWNRIATQTLTVYQ
RILR

Enzyme Prediction     

No EC number prediction in MGYG000001253_01682.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	198	336	1e-23	0.8875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.96e-42	11	307	6	303	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03798	GT4_WlbH-like	1.56e-34	15	303	10	308	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
COG0438	RfaB	4.20e-34	1	364	1	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03809	GT4_MtfB-like	1.07e-31	12	307	7	305	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03808	GT4_CapM-like	6.25e-31	19	307	10	299	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD34526.1	5.93e-122	4	364	1	360
AHF12040.1	3.33e-114	4	362	1	361
BCI64460.1	2.86e-110	4	363	1	362
BAN68889.1	1.40e-109	4	359	1	360
QDO70344.1	1.17e-107	4	363	1	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TVP_A	3.28e-23	15	362	26	399	Structureof Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155],6TVP_B Structure of Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R2E2	1.55e-22	15	362	12	385	Alpha-maltose-1-phosphate synthase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glgM PE=1 SV=1
P9WMY8	5.33e-13	15	359	12	390	Glycogen synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3116 PE=3 SV=1
P9WMY9	5.33e-13	15	359	12	390	Glycogen synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3032 PE=1 SV=1
B2SUK8	1.22e-09	19	304	15	301	GDP-mannose:cellobiosyl-diphosphopolyprenol alpha-mannosyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) OX=360094 GN=gumH PE=3 SV=1
Q65CC1	3.97e-09	68	363	54	383	2-deoxystreptamine glucosyltransferase OS=Streptomyces kanamyceticus OX=1967 GN=kanF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001253_01682.