CAZyme Information: MGYG000001253_01939

Basic Information

• Species: Paramuribaculum sp001689535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp001689535
• CAZyme ID: MGYG000001253_01939
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261		29053.05	6.634

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001253	2271514	MAG	Austria	Europe

• Gene Location: Start: 5838; End: 6623 Strand: +

Full Sequence      

MKTKLLLAAVFCAVNFLSASAVSPGLNDAYSRESFTDKAGTVLSYRMLKPEKINPEEKYP
LVVFLHGADERGSDNESQLFHGGSVFSNPVNMTKYPAFVIFPQCPAGERWAEYNKQNSFN
DNAETPDESKNEKAIICLIEKLVADYPIDTDRLYITGLSMGGMGTFDLVCRHPDLFAAAI
PICGAVNPTRLPAAKNVRFRIFHGANDDSVPTIWSRKAYKALKDAGAEVEYIEFAGTPHD
SWNPAFNRPDFLPWLFSQKKK

Enzyme Prediction     

No EC number prediction in MGYG000001253_01939.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	40	233	1.3e-30	0.8678414096916299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	6.45e-45	26	259	157	386	Predicted peptidase [General function prediction only].
COG0400	YpfH	1.42e-14	60	236	19	186	Predicted esterase [General function prediction only].
COG1506	DAP2	5.92e-14	14	239	360	594	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG3509	LpqC	1.14e-13	3	212	8	206	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
TIGR01840	esterase_phb	5.73e-13	58	184	12	128	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABS60377.1	4.23e-52	43	261	22	246
BCI61582.1	1.53e-47	43	259	825	1042
ACR12533.1	3.24e-32	26	259	44	280
QJW99051.1	1.50e-31	7	260	9	240
ANB19106.1	8.25e-26	43	259	44	248

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	4.53e-53	28	260	142	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	2.60e-27	40	261	18	218	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4Q82_A	3.84e-08	57	260	78	277	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]
5YP1_A	3.99e-08	41	239	502	721	Crystalstructure of dipeptidyl peptidase IV (DPP IV) from Pseudoxanthomonas mexicana WO24 [Pseudoxanthomonas mexicana],5YP1_B Crystal structure of dipeptidyl peptidase IV (DPP IV) from Pseudoxanthomonas mexicana WO24 [Pseudoxanthomonas mexicana],5YP1_C Crystal structure of dipeptidyl peptidase IV (DPP IV) from Pseudoxanthomonas mexicana WO24 [Pseudoxanthomonas mexicana],5YP1_D Crystal structure of dipeptidyl peptidase IV (DPP IV) from Pseudoxanthomonas mexicana WO24 [Pseudoxanthomonas mexicana],5YP2_A Crystal structure of dipeptidyl peptidase IV (DPP IV) with DPP4 inhibitor from Pseudoxanthomonas mexicana WO24 [Pseudoxanthomonas mexicana],5YP2_B Crystal structure of dipeptidyl peptidase IV (DPP IV) with DPP4 inhibitor from Pseudoxanthomonas mexicana WO24 [Pseudoxanthomonas mexicana],5YP3_A Crystal structure of dipeptidyl peptidase IV (DPP IV) with Ile-Pro from Pseudoxanthomonas mexicana [Pseudoxanthomonas mexicana],5YP3_B Crystal structure of dipeptidyl peptidase IV (DPP IV) with Ile-Pro from Pseudoxanthomonas mexicana [Pseudoxanthomonas mexicana],5YP3_C Crystal structure of dipeptidyl peptidase IV (DPP IV) with Ile-Pro from Pseudoxanthomonas mexicana [Pseudoxanthomonas mexicana],5YP3_D Crystal structure of dipeptidyl peptidase IV (DPP IV) with Ile-Pro from Pseudoxanthomonas mexicana [Pseudoxanthomonas mexicana],5YP4_A Crystal structure of dipeptidyl peptidase IV (DPP IV) with Lys-Pro from Pseudoxanthomonas mexicana WO24 [Pseudoxanthomonas mexicana],5YP4_B Crystal structure of dipeptidyl peptidase IV (DPP IV) with Lys-Pro from Pseudoxanthomonas mexicana WO24 [Pseudoxanthomonas mexicana],5YP4_C Crystal structure of dipeptidyl peptidase IV (DPP IV) with Lys-Pro from Pseudoxanthomonas mexicana WO24 [Pseudoxanthomonas mexicana],5YP4_D Crystal structure of dipeptidyl peptidase IV (DPP IV) with Lys-Pro from Pseudoxanthomonas mexicana WO24 [Pseudoxanthomonas mexicana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P52090	7.13e-08	60	214	66	206	Poly(3-hydroxyalkanoate) depolymerase C OS=Paucimonas lemoignei OX=29443 GN=phaZ1 PE=3 SV=1
Q6F3I7	2.18e-07	41	239	502	721	Dipeptidyl aminopeptidase 4 OS=Pseudoxanthomonas mexicana OX=128785 GN=dap4 PE=1 SV=1
Q4WBW4	4.05e-06	10	184	6	174	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1
A1DBP9	5.40e-06	9	184	9	174	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000320	0.998932	0.000204	0.000182	0.000176	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001253_01939.