CAZyme Information: MGYG000001256_01192

Basic Information

• Species: CAG-354 sp001915925
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-354; CAG-354 sp001915925
• CAZyme ID: MGYG000001256_01192
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		42881.99	5.7835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001256	1702469	MAG	Austria	Europe

• Gene Location: Start: 21941; End: 23095 Strand: +

Full Sequence      

MLKGIDISKWQAGIDLNKINCDFVIIKATEGKSYVDPSCDIFFQEALNLNKKIGIYHFAN
NSDNTAEQEADWFIKNTKGYIGKAIPILDFEDKGATHDVAWAKRWLDRVAEAYGCKPLIY
MSESVVNSYDWSSVANANYGLWVAKYRDNNADYNYDMSNAGRNPAVRHWKFYALWQWTSS
GRLDGYNGNLDCNVFYGDKEAWDKYIGNEIPPHEENNTDTVVTPPVESSTVSYEVQSGDN
LTKIAKKYGTTVDEIVRLNNISDPNLIYVGQYLVIPTTSNAQVSTDSTYVVKSGDTLSGI
ANKFGTTYQKLAEINGISNPNIIYPGQVLKINGTTANSTKTYTIQSGDNLTKIAKQFNTT
VDSLVSKNGIKDKNKIYVGQVLKI

Enzyme Prediction     

No EC number prediction in MGYG000001256_01192.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	5	185	1.1e-44	0.9887005649717514
CBM50	233	276	5.1e-16	0.975
CBM50	289	331	5.8e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06417	GH25_LysA-like	2.04e-66	2	202	1	195	LysA is a cell wall endolysin produced by Lactobacillus fermentum, which degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. The N-terminal glycosyl hydrolase family 25 (GH25) domain of LysA has sequence similarity with other murein hydrolase catalytic domains while the C-terminal domain has sequence similarity with putative bacterial cell wall-binding SH3b domains. This domain family also includes LysL of Lactococcus lactis.
cd00599	GH25_muramidase	1.45e-40	3	195	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	2.88e-38	5	185	1	179	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	1.81e-33	3	195	1	184	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06524	GH25_YegX-like	1.03e-30	3	197	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK61131.1	4.01e-91	2	212	3	213
QCT71511.1	6.02e-90	1	332	1	326
QCT70818.1	8.51e-90	1	332	1	326
BBK23905.1	2.83e-89	2	212	3	213
QOP65129.1	3.84e-86	2	331	3	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	1.87e-20	2	205	16	216	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
4B8V_A	1.22e-17	207	380	18	212	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
5A6S_A	7.62e-13	1	209	21	212	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]
5JIP_A	1.04e-12	4	193	16	220	Crystalstructure of the Clostridium perfringens spore cortex lytic enzyme SleM [Clostridium perfringens],5JIP_B Crystal structure of the Clostridium perfringens spore cortex lytic enzyme SleM [Clostridium perfringens]
6ZMV_A	6.97e-12	4	191	4	198	ChainA, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q49UX4	1.99e-31	232	384	28	193	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q5HRU2	5.58e-25	232	384	28	190	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q8CMN2	5.58e-25	232	384	28	190	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q6GJK9	7.68e-23	228	384	24	201	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=sle1 PE=3 SV=1
Q2FJH7	1.44e-22	228	384	24	201	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain USA300) OX=367830 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001256_01192.