CAZyme Information: MGYG000001257_01737

Basic Information

• Species: Massiliomicrobiota sp002160865
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Massiliomicrobiota; Massiliomicrobiota sp002160865
• CAZyme ID: MGYG000001257_01737
• CAZy Family: GT4
• CAZyme Description: N,N'-diacetylbacillosaminyl-diphospho-undecaprenol alpha-1,3-N-acetylgalactosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		42391.66	9.0808

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001257	2104226	MAG	Austria	Europe

• Gene Location: Start: 902; End: 1999 Strand: -

Full Sequence      

MKKILILANNDVGLYKFRKELIQELLKKYEVYISLPNGEFIPELIKMGCHFIDTPVDRRG
MNPFTDLSLLKRYFSMIKRLKPHLVVTYTIKPNVYGGFTSRVLHIDYAMNVTGLGTAFQS
ENLTKKLACFLYKIACKKAKIVFFENKGNKEVFIKNHLINEEQPYVLHGAGVNLDEYPMT
PYPKDQKLIRFLFIGRVMKEKGIDELLEAATKIKKEYPNVEFDIVGPMEDNYKSILETMV
HQHTIHYYGLQTDVKPFIKQCHCFVLPSYHEGMANTLLESASMGRPLITSNIHGCMEAIH
ENGYLCKVQDSQDLYYQLKKFIELDYQSKIKMGLESRKHMENVFDKNKIVSQTIKHLPID
KEVNK

Enzyme Prediction     

No EC number prediction in MGYG000001257_01737.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	191	329	3.9e-31	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03808	GT4_CapM-like	4.10e-111	3	353	1	357	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03801	GT4_PimA-like	2.93e-36	3	357	1	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam13692	Glyco_trans_1_4	2.24e-29	190	314	3	128	Glycosyl transferases group 1.
cd03811	GT4_GT28_WabH-like	1.05e-28	3	324	1	328	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03807	GT4_WbnK-like	1.62e-27	38	350	41	354	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL39550.1	2.07e-162	2	357	3	361
QWI24610.1	6.80e-127	1	357	1	358
AXI28006.1	1.51e-126	1	357	1	360
AVX07237.1	1.68e-125	1	357	1	357
QWI13768.1	3.05e-125	1	351	1	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PQG_A	2.01e-06	145	305	290	449	Crystalstructure of the pneumococcal O-GlcNAc transferase GtfA in complex with UDP and GlcNAc [Streptococcus pneumoniae TIGR4],4PQG_B Crystal structure of the pneumococcal O-GlcNAc transferase GtfA in complex with UDP and GlcNAc [Streptococcus pneumoniae TIGR4]
7EC2_A	3.49e-06	194	322	324	457	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC2_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0P9C9	6.76e-34	7	355	6	367	N,N'-diacetylbacillosaminyl-diphospho-undecaprenol alpha-1,3-N-acetylgalactosaminyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglA PE=1 SV=1
P39862	4.04e-15	5	344	9	357	Capsular polysaccharide biosynthesis glycosyltransferase CapM OS=Staphylococcus aureus OX=1280 GN=capM PE=3 SV=1
Q58459	8.96e-14	63	291	63	307	Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1059 PE=3 SV=1
Q93P60	3.09e-08	29	240	33	263	Alpha-monoglucosyldiacylglycerol synthase OS=Acholeplasma laidlawii OX=2148 GN=mgs PE=1 SV=1
P9WMY8	5.69e-08	171	353	199	386	Glycogen synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3116 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001257_01737.