CAZyme Information: MGYG000001258_00952

Basic Information

• Species: Rothia sp902373285
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia sp902373285
• CAZyme ID: MGYG000001258_00952
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
655	MGYG000001258_12|CGC1	72280.64	7.58

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001258	2162110	MAG	Italy	Europe

• Gene Location: Start: 1806; End: 3773 Strand: +

Full Sequence      

MAEQHSDRPAPAQHPAKHDGQPEPRTVAVVVTYNRRDLLPKTLAGIASGRMRPVAVVIVD
NASTDDTAAYLDSLEYELPVDRITLRQNMGGAGGFAVGIDRALERHNPDLVWVMDDDTEP
TENTLAEAVEAWLGYSEVPSERPAVVASRVVWTNGEDHPMNTPRTMFAAGEQRHARARAV
GARPIRSASFVSILMDAQAIRRNGGLPIAEFFIWNDDFEFSTRLIHHRNGIAVSSSVAKH
HTKTFGTTNANPGPRFYNDVRNKLWVFTRSRTLNPLEKLLYGGSSARLWVSTLLRTDDRR
TYLGYFLNGLRDGLRPPVPNRRVLEGIYPLTFPGRYGVPASNPEPAATGNAGCVSSAPDF
SVLMSVYAKENPAYLDQALESNLLNQTLRPSELVLVLDGPLTPELRAVVDRWVARAESLD
CPPIQLVELPQNIGLAEALNAGLQACSYELVARADSDDLSEPTRFAELIPALVEGGYTLL
GSAMLEVNESNSEVESVREAIVDSERLLRAMDSRNPIYHPSVAFRKSAVLTLGGYEYVPG
AEDWWLWMRLRDAGYRLGNLPAPLVRYRVGAGAYTKRGGVDAWKQDWAIQRRLYTGHAIS
KTRWVQNMAVRSVYRFVPESLRRSAFRALSTVAARASFTRSSSGRSTGAASEGGF

Enzyme Prediction     

No EC number prediction in MGYG000001258_00952.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	28	170	4.1e-19	0.788235294117647
GT2	361	524	7.9e-17	0.9352941176470588

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04195	GT2_AmsE_like	8.83e-67	361	568	1	201	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04185	GT_2_like_b	2.38e-59	28	266	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.51e-25	23	315	2	302	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	3.15e-16	29	150	2	112	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	3.90e-16	29	167	3	132	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAS19389.1	0.0	24	654	34	658
QXW98740.1	0.0	1	654	1	653
ATF62567.1	0.0	1	654	1	654
BAI65128.1	0.0	1	654	6	664
QXW93103.1	1.78e-315	25	629	23	621

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48215	2.10e-42	360	621	3	256	Uncharacterized glycosyltransferase HI_1695 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1695 PE=3 SV=2
Q46635	3.03e-38	360	618	2	252	Amylovoran biosynthesis glycosyltransferase AmsE OS=Erwinia amylovora OX=552 GN=amsE PE=3 SV=2
Q03084	6.65e-37	358	622	6	263	UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-galactosyltransferase OS=Escherichia coli OX=562 GN=wbbD PE=1 SV=1
Q4KXC9	1.16e-14	361	569	10	209	O-antigen biosynthesis glycosyltransferase WbnJ OS=Escherichia coli OX=562 GN=wbnJ PE=1 SV=1
P71054	1.47e-12	354	577	1	216	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001258_00952.