CAZyme Information: MGYG000001259_00523

Basic Information

• Species: Succiniclasticum sp900316935
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Succiniclasticum; Succiniclasticum sp900316935
• CAZyme ID: MGYG000001259_00523
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000001259_6|CGC2	42081.9	8.1235

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001259	2073628	MAG	Italy	Europe

• Gene Location: Start: 78829; End: 79926 Strand: -

Full Sequence      

MKKLLFSAVLLLILAVQTPGSARAPRPRDTEVPPLTGKINLVWQHANEPSVDLSRLDKVQ
GLNVVSPCWYVIANEYGQVADRSVEGYVQRAHARGYRVWPLVTNGFDPERTRRVLNDVNA
QHHVIDQLLEQAQKHRFDGINLDFENIYEADRDKLTDFVRRIRHKTNEAGLALSMDVTVP
GGSPNWSLCYDRKALARHLDYVMLMAYDQYPRGSRTPGPTASYNWDADRLAATLEEVPAR
KLVLGIPFYMRLWQYDAATDRWRAETLTMPQAEKRRAEKGILPTWQSDWLPDMQMFRCSY
EENGTKYMFWLENTASLYLKMHLVNQYDLAGCAAWRFGFETPDVWPMLQDRLENGGKGFR
TQAAR

Enzyme Prediction     

No EC number prediction in MGYG000001259_00523.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	92	339	2.8e-37	0.7601351351351351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	6.24e-79	61	348	25	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	6.10e-51	62	352	127	422	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
pfam00704	Glyco_hydro_18	9.64e-27	124	335	92	302	Glycosyl hydrolases family 18.
smart00636	Glyco_18	4.35e-26	90	335	61	329	Glyco_18 domain.
cd06549	GH18_trifunctional	5.63e-26	57	345	19	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEQ23268.1	2.43e-134	1	355	7	366
BDA10778.1	2.39e-95	38	353	37	347
QIB60827.1	1.36e-94	38	353	37	347
SNU93874.1	9.05e-93	38	353	34	344
QJW48079.1	8.76e-90	18	353	150	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	1.32e-25	72	336	49	307	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	2.48e-21	119	352	87	314	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4S3K_A	1.23e-16	102	353	177	428	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	7.15e-16	102	358	176	431	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
3AQU_A	4.95e-09	125	338	97	328	Crystalstructure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana],3AQU_B Crystal structure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana],3AQU_C Crystal structure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana],3AQU_D Crystal structure of a class V chitinase from Arabidopsis thaliana [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	1.26e-27	77	349	66	340	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O05495	1.66e-25	72	345	141	409	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O31682	1.79e-25	53	253	16	212	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
P37531	3.24e-20	101	360	173	431	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	2.88e-15	102	358	175	430	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000224	0.999165	0.000153	0.000163	0.000140	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001259_00523.