CAZyme Information: MGYG000001260_00917

Basic Information

• Species: Acinetobacter johnsonii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter johnsonii
• CAZyme ID: MGYG000001260_00917
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390		43541.16	9.0521

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001260	3024365	MAG	Italy	Europe

• Gene Location: Start: 5671; End: 6843 Strand: -

Full Sequence      

MQNRKLKIGIVVGEVSGDTLGAKLICSFREQGIDAEFEGIGGPQMIAEGFKSFYPMDILS
VMGLVEVLKDIKKLFAVRDGLVEKWTAHPVDVFIGIDAPDFNLRLSKSLKQKQLPIKTVQ
YVSPSVWAWRQGRVHGIKASIDLVLCLFPFEKAFYKKWDVPAAFVGHPLASQLPLENPIL
QAKEELGLDLTQKHIALLPGSRRGEIEKLGPLVLDAAKLLYAKYPNYRFVIPAINDARKQ
QIEALLAQYPKALVDQIDLLENSGTESKIGRQVMNAANIVALASGTATLEAMLLHRPMVT
FYKLNWLTYHVVKFLIKIQYYSLPNIIAGKKVIQELIQKDATPEKLAAEIEKLMNIETAQ
IQAMQHITMHKQLLAGNSENPVEAILNILD

Enzyme Prediction     

No EC number prediction in MGYG000001260_00917.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	370	1.1e-126	0.980225988700565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.71e-163	6	390	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.23e-138	6	389	2	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.68e-109	8	362	1	348	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.77e-100	1	374	1	365	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.55e-46	54	346	43	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZN63875.1	7.47e-280	1	390	1	390
ALV73135.1	2.14e-279	1	390	1	390
QBK69618.1	2.14e-279	1	390	1	390
QEK35931.1	3.04e-279	1	390	1	390
AXF45399.1	6.14e-279	1	390	1	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	9.65e-92	2	388	3	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.36e-91	2	388	3	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6FA07	5.09e-202	1	389	7	395	Lipid-A-disaccharide synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=lpxB PE=3 SV=1
A1SYV0	1.15e-111	3	390	2	378	Lipid-A-disaccharide synthase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lpxB PE=3 SV=1
Q2SBR1	2.77e-108	1	390	4	383	Lipid-A-disaccharide synthase OS=Hahella chejuensis (strain KCTC 2396) OX=349521 GN=lpxB PE=3 SV=1
A3QG90	1.84e-105	2	390	3	380	Lipid-A-disaccharide synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) OX=323850 GN=lpxB PE=3 SV=1
Q21HI5	8.95e-105	7	389	6	380	Lipid-A-disaccharide synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) OX=203122 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001260_00917.