CAZyme Information: MGYG000001260_01208

Basic Information

• Species: Acinetobacter johnsonii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter johnsonii
• CAZyme ID: MGYG000001260_01208
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		41509.1	10.0829

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001260	3024365	MAG	Italy	Europe

• Gene Location: Start: 1141; End: 2253 Strand: +

Full Sequence      

MHSSSTSGSRLCLNSLTFSLPLKALALSTLLIPFHSINASKTYQYDNVVNHNKLTVVSVE
NPTTVFKDGQHLHGFGYDLARNYADSLNVKLDFKTVPDNATALKWVAQGKANFAMTTASV
QTIEQKSLATFSATCGDLNVLRKNGLNTELNWVFKHANDPLTQTASGFVCRGKQSGSIGQ
LASFYNRNVVKPENWNTIQRDLRQRMPIYKASFKSTAQKYDLDWHLLAAIGYQESYLKPN
SVSPTGVRGLMMLTNSTAKAMGVSNRTDPAQSIQGGAKYYDQMLSRYDDIPFPDRNWYAL
VAYNMGPGAVNQIQKRIQAQGKDPNNWLNLYVYLQQNQAKNGRYRQALQYVTRIRAYLEH
IKTTPQLVNI

Enzyme Prediction     

No EC number prediction in MGYG000001260_01208.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	222	363	2.5e-24	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	2.20e-67	213	363	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	1.37e-65	9	357	2	446	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	4.06e-52	86	361	158	431	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	4.39e-24	217	323	5	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.05e-22	226	359	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALV72230.1	1.04e-269	1	370	1	370
QBK70507.1	1.04e-269	1	370	1	370
QPF34229.1	1.48e-269	1	370	1	370
QEK35121.1	1.48e-269	1	370	1	370
QKY91350.1	4.24e-269	1	370	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	6.67e-42	158	330	206	381	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	7.59e-42	158	330	213	388	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	7.59e-42	158	330	213	388	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_A	1.40e-41	158	330	199	374	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_B	1.40e-41	158	330	199	374	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4VP14	9.92e-43	145	330	222	411	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=mltF PE=3 SV=2
Q02RN8	3.88e-42	150	330	229	412	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=mltF PE=3 SV=2
A1U3J1	4.76e-42	148	334	222	412	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
Q9HXN1	1.05e-40	158	330	238	413	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mltF PE=1 SV=2
A6V102	1.05e-40	158	330	238	413	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.124801	0.872655	0.001454	0.000559	0.000254	0.000239

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001260_01208.