CAZyme Information: MGYG000001260_01508

Basic Information

• Species: Acinetobacter johnsonii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter johnsonii
• CAZyme ID: MGYG000001260_01508
• CAZy Family: GT25
• CAZyme Description: Lipooligosaccharide biosynthesis protein lex-1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256		29574.61	8.4235

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001260	3024365	MAG	Italy	Europe

• Gene Location: Start: 3460; End: 4230 Strand: -

Full Sequence      

MKNIVISLKTATARREHIVQEFGKQNIGFEFFDALTPNLARPLAEQMQLNIHDDFLSPGE
LACFMSHVSIWQKMVDEQIPHLAIFEDDVYLGKDAAELLNNSDWISTEWDIIKTEAFADQ
VFLGKTQSEIANGMRYIVQLIGKNLGTAGYILSFVGAQKYLEYVKKIQLIPLDQVMFDEF
VRHTFHPVYQMTPALCIQEMMLYPEKKTVLSSDLLAERKARMKKQKKKGWAKIQLEVLRI
LKQVKYALVAKRVEFK

Enzyme Prediction     

No EC number prediction in MGYG000001260_01508.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	2	176	5.3e-37	0.9834254143646409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01755	Glyco_transf_25	1.74e-43	2	176	3	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
COG3306	COG3306	2.21e-42	1	221	3	224	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
cd06532	Glyco_transf_25	1.27e-34	2	176	1	128	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYA67840.1	3.36e-154	1	256	1	256
QKY91661.1	4.36e-150	1	256	1	256
QEK34815.1	3.57e-149	1	256	1	256
QKQ69253.1	3.41e-147	1	256	1	256
QQN88565.1	3.30e-138	1	255	1	255

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q05770	2.11e-46	1	256	1	263	Lipooligosaccharide biosynthesis protein LpsA OS=Mannheimia haemolytica OX=75985 GN=lpsA PE=3 SV=2
Q57394	1.64e-39	3	228	4	232	Lipooligosaccharide biosynthesis protein lic2B OS=Haemophilus influenzae OX=727 GN=lic2B PE=3 SV=1
Q57125	1.04e-37	3	205	34	236	Putative glycosyltransferase HI_0765 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0765 PE=3 SV=1
Q51117	1.63e-35	1	218	1	229	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtE OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lgtE PE=3 SV=2
Q03974	3.79e-35	1	246	4	284	Lipooligosaccharide biosynthesis protein lex-1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=lex1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001260_01508.