CAZyme Information: MGYG000001261_00250

Basic Information

• Species: Caulobacter sp903900155
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Caulobacterales; Caulobacteraceae; Caulobacter; Caulobacter sp903900155
• CAZyme ID: MGYG000001261_00250
• CAZy Family: GH55
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
998		106850.96	7.1069

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001261	5012197	MAG	Italy	Europe

• Gene Location: Start: 7575; End: 10571 Strand: -

Full Sequence      

MKRWLVAAAAVALVCAAGEPALASISAFATTPDDPAAIVAKPKGDGRTDDTAALQAALDA
AAAKPGGGLVFLPSGRYRISKTLFLWPGVRLFGVGATRPEIVLGEATPGFQKGLANMLIF
AGAKPDPARASKPAFPPPGSVPFNKDIADANPGSFYSAISNVDFTIGKGNPAATAIRFHA
AQHAVLSHMTFDIGSGLAGLYHVANEAEDLRFKGGRYGILAEKPSAAWGFVLLDSTFEGQ
REAAIREHEAGLTLVNVAMKDTPVGVEIDRGYGDWLWGRDVRFENVSKAGVVISNERNVY
TQVGFENASAINTPVFARFRDSGKTTSGKGKAYRIAAFNHGLTVPGLGQTGDYKTTFEAE
AVSTPKSAKPAIRALPPTSEWTNVRSLGAKGDNTSDDTAAIQKAIDAHRVVYFPTGFYRV
TDTLKLKPDTVLIGLHPSLTQIVLPHATPAFQGVGAPKALVQSADGGDNIVFGLGLYTDG
VNPRATALLWTAGASSMVNDVKFQGGHGTNLFDGARFSPYNNNATADADATKRWGGTFSN
IWSPSTYAYSGIYVSDTKTPGHVYQVSVEHHLRTEISLNRVANWEFLAPQTEEEAGEGED
TVSLEIRDSSNILLANYHAYRVTRTRRPAPAAVRIYNSYDIRFRNVAVNGESGFGTCDDN
GCGTFTRLTKYPYENAIQDITSGLEVRERQFAVLDIGGAPKPVKPSVFPAGATVEKLGDG
FYSLGGGAVDAAGTLYFTDRRNQRIYSWSDERKLSIVRDNTLDPVNLAVDASGNLLVLSS
EGRNASVYSFKPGSPDTEATVIAPTPAGEGGKAATVLPVNWWNNGEFKDQLNLDAYEFTT
LAELFAHDMARPKTKEYVSPDGSLVLPAYRVFASGPPDYRGLRFSDSLDTYGFTTARPGQ
RVFIANSSENKTYSGLVGQKGAITDLKVFAERGGESVAVDAEGRVYVANGQVFVYAPDGK
EVGRLDIPERPLQLLFGGTGKRTLYVLTHHTLYAVRSK

Enzyme Prediction     

No EC number prediction in MGYG000001261_00250.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	150	645	1.3e-93	0.7067567567567568

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12708	Pectate_lyase_3	1.43e-18	381	559	1	210	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
pfam12708	Pectate_lyase_3	1.34e-14	43	267	10	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
pfam08450	SGL	2.29e-11	724	990	1	246	SMP-30/Gluconolaconase/LRE-like region. This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30), gluconolactonase and luciferin-regenerating enzyme (LRE). SMP-30 is known to hydrolyze diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 and LRE.
COG3386	YvrE	4.39e-10	697	991	2	277	Sugar lactone lactonase YvrE [Carbohydrate transport and metabolism].
COG5434	Pgu1	3.30e-04	325	432	28	137	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ02067.1	0.0	1	996	1	1008
ADG10335.1	0.0	1	996	1	1008
AUW59623.1	0.0	1	996	1	1011
AHE56386.1	0.0	13	996	3	1004
QOT73482.1	0.0	7	996	8	1011

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	1.71e-16	44	490	38	495	ChainA, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	2.25e-16	43	434	58	456	ChainA, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
3E5Z_A	3.71e-10	699	985	5	272	X-Raystructure of the putative gluconolactonase in protein family PF08450. Northeast Structural Genomics Consortium target DrR130. [Deinococcus radiodurans],3E5Z_B X-Ray structure of the putative gluconolactonase in protein family PF08450. Northeast Structural Genomics Consortium target DrR130. [Deinococcus radiodurans]
7CHU_A	1.78e-06	383	459	76	166	ChainA, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000356	0.998964	0.000187	0.000173	0.000149	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001261_00250.