CAZyme Information: MGYG000001261_00364

Basic Information

• Species: Caulobacter sp903900155
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Caulobacterales; Caulobacteraceae; Caulobacter; Caulobacter sp903900155
• CAZyme ID: MGYG000001261_00364
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MGYG000001261_13|CGC1	34975.69	9.3925

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001261	5012197	MAG	Italy	Europe

• Gene Location: Start: 7074; End: 8033 Strand: -

Full Sequence      

MIDARLVLGLLLATALSNVALAETLRVGPKASYKTLTAAVEALPADGGTIELAPGEYREK
VTIAKPNVRLVGEGARPQDVVIVWSDGARNAGGTFKSFTMNVTGDGFKAKNLTIQNDYRL
KDPNPSQAVALAITADRAVLEKVRLLGAQDTLYAASKKDKPSRQYFKDCYIEGHVDFIFG
DAKAFFDRCHIHGIAHQSVMITAQSKNRPDQDSAYVFDRTLITADKDATGIFFGRAWRPL
ATVIFMRSRIEAPLDPAGWREWTPGKTDTLSTAYFAEYASTGPGASPKTREPRTHQLTDD
QAKAWDRRKFLAGPDGWNP

Enzyme Prediction     

No EC number prediction in MGYG000001261_00364.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	312	1.5e-86	0.9652777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	1.72e-67	25	311	7	296	pectinesterase
pfam01095	Pectinesterase	2.23e-67	33	313	12	297	Pectinesterase.
PLN02682	PLN02682	9.15e-62	14	303	60	353	pectinesterase family protein
PLN02665	PLN02665	5.29e-61	24	303	69	346	pectinesterase family protein
PLN02432	PLN02432	2.46e-58	30	317	20	291	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYV48052.1	5.04e-138	5	319	9	325
QOZ24022.1	8.35e-120	28	317	30	321
BBC02356.1	3.39e-117	30	317	32	321
QOZ15608.1	3.39e-117	30	317	32	321
QOZ36300.1	9.04e-115	30	317	32	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	6.22e-38	33	299	15	285	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	9.11e-38	33	290	19	278	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	5.18e-33	25	294	11	275	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.75e-32	25	294	11	275	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.98e-23	32	319	17	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8VYZ3	2.46e-45	30	315	93	379	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9LVQ0	7.88e-45	33	311	17	296	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9ZQA3	3.37e-42	32	317	100	384	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1
Q8GXA1	4.28e-42	33	319	268	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
O23038	6.95e-42	32	317	100	387	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000256	0.999042	0.000195	0.000174	0.000167	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001261_00364.