CAZyme Information: MGYG000001261_00366

Basic Information

• Species: Caulobacter sp903900155
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Caulobacterales; Caulobacteraceae; Caulobacter; Caulobacter sp903900155
• CAZyme ID: MGYG000001261_00366
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295	MGYG000001261_13|CGC1	31185.53	9.3218

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001261	5012197	MAG	Italy	Europe

• Gene Location: Start: 10396; End: 11283 Strand: -

Full Sequence      

MRLKALTLAAALALTPLAAHAQTAPTQTTQAEAAPTKFRAIKIVLIGDSTTAVLGGWGPS
FCGWHVTSFAACINLARGGRSSGNYRSEGSWALAMDEIKSGGFTDTYVLIQFGHNDQPGK
PGRSTDLATEFPVNMKRYVDEVRAAGGKPILLTPLTRRQFKDGKLQDDLGPWAEAVRKVA
AETNTPLVDLHARSQAAVQAMGPVEAMRFAQRAPSAEVVDAATKTGTTIPASTGVPVAHG
APPMAQNNAAVEPMGQAKLSFDYTHLGVAGADYFSAIVTDELSKSVPALRRYLIQ

Enzyme Prediction     

No EC number prediction in MGYG000001261_00366.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	42	282	8.7e-62	0.9952380952380953

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	2.74e-70	41	282	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
COG2755	TesA	3.95e-16	40	191	8	172	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
cd01838	Isoamyl_acetate_hydrolase_like	2.12e-11	42	191	1	163	Isoamyl-acetate hydrolyzing esterase-like proteins. SGNH_hydrolase subfamily similar to the Saccharomyces cerevisiae IAH1. IAH1 may be the major esterase that hydrolyses isoamyl acetate in sake mash. The SGNH-family of hydrolases is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases
pfam13472	Lipase_GDSL_2	2.77e-10	45	191	1	148	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	1.99e-08	43	195	1	158	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYV44996.1	3.80e-152	1	294	1	295
AUN32900.1	2.32e-129	39	294	30	283
QTC87435.1	5.12e-126	17	294	5	283
QYF88193.1	2.76e-124	17	294	12	297
QAY80108.1	3.54e-124	37	294	15	274

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31528	1.97e-21	43	196	5	160	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
O31523	7.23e-21	39	209	4	174	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000374	0.998815	0.000184	0.000241	0.000191	0.000167

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001261_00366.