CAZyme Information: MGYG000001261_01444

Basic Information

• Species: Caulobacter sp903900155
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Caulobacterales; Caulobacteraceae; Caulobacter; Caulobacter sp903900155
• CAZyme ID: MGYG000001261_01444
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
649	MGYG000001261_73|CGC1	72486.84	4.6324

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001261	5012197	MAG	Italy	Europe

• Gene Location: Start: 7535; End: 9484 Strand: +

Full Sequence      

MSKPSIDVLGSRFVDAHGRHAILRGVNLGGDCKVPWPDGGTDRPSDFSDHRTVSFVGRPF
PLEEADTHLARIARWGFNTLRLLTTWEAVEHAGPGQYDEDYLDYFTAVVERAQAHGLFVF
VDFHQDVWSRMSGGDGAPGWVFEALGLDFARFDAADAAHVMQHRYDYTSEERRQEDRYPM
MSWASNYRMAANGIAWSAFFAGQILTPDWTVEGRNVQHFLQDHYLGAMAAVARRVAHLDN
VIGFDTFNEPGLGWVGLPMSQPRLKATPEDSLPVWPGAAWTPLDGLRAARGRTVDVANLG
WSDERGVLRELDRQTANEAGVSIWRDEGPDPFEQAGAWRFDDNGDVVLDEDFFRLKDGQP
IDHENQCMGPFFARVAETVRAVRPDWLLFAELCPYLVGTGRFFPDAMPERSVNASHWYDI
DILRKKRFDPDQHTDPLKAKYFNQMAYIAWLGSKFGTDGAPTLIGEFGIPYDLNHGEAFE
AWARGERGKGVWAAHAQALSLMYDALDALKLSSTQWNYTAGNRNDLRVGDGWNQEDLSIF
SPDQIDGIAPNDPDAGARALLGFCRPYAPLAQGVITTMRYAEDRFELEMEADPAIDAATQ
IYVPQVRFPNGVSVSVSQGAARWTHDREAQQVLVWAAEAGPLSIVVEPA

Enzyme Prediction     

No EC number prediction in MGYG000001261_01444.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	15	524	7e-152	0.9981447124304267

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18564	Glyco_hydro_5_C	2.65e-13	565	646	1	86	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
pfam00150	Cellulase	6.92e-08	14	126	1	88	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	0.002	72	124	82	137	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATQ42414.1	3.43e-309	1	646	1	644
QYC14637.1	1.94e-282	1	644	1	643
QYC11851.1	1.94e-282	1	644	1	643
AXQ31277.1	2.38e-254	1	646	1	644
QGN55669.1	2.66e-246	1	647	1	643

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LPO_A	3.51e-78	13	620	28	728	ChainA, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99]
5CCU_A	2.01e-12	10	256	48	226	ChainA, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5CCU_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
5J14_A	2.01e-12	10	256	48	226	ChainA, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J14_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_A Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
H1AE12	3.67e-78	5	635	15	666	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1
I1BTD7	1.17e-76	10	626	19	647	Glucosylceramidase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=ERC1 PE=1 SV=1
H1AE13	4.81e-72	10	546	10	568	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1
P40566	8.52e-54	12	543	12	582	Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1
A0A3S5YBC7	1.08e-11	10	256	40	218	Endoglycoceramidase I OS=Rhodococcus hoagii (strain 103S) OX=685727 GN=REQ_38260 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001261_01444.