CAZyme Information: MGYG000001261_01840

Basic Information

• Species: Caulobacter sp903900155
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Caulobacterales; Caulobacteraceae; Caulobacter; Caulobacter sp903900155
• CAZyme ID: MGYG000001261_01840
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		41233.83	6.8772

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001261	5012197	MAG	Italy	Europe

• Gene Location: Start: 977; End: 2143 Strand: -

Full Sequence      

MLKVMLVAAEASGDTLGASLAKALRARLDDQVTFVGVGGAKMAEQGVESPFDIAHLSILG
IWEGLKAYPTVKARLDDTVALAAREKPDVAVLIDSWGFNIRLAKALRKLDPKLPLVKYVA
PQVWAYREGRAQGLARAVDLLLSIQPMDKPYFDAAGLENVFVGNSALAKRFDHADGARLR
TAVGASATDQVLLVLPGSRPSEIERVMPAFEDAVRRLKAERPELVVVIPAAYTVVEAVKA
RVAGWPFRAHVIEDEALKDDAFVAGDVALACSGTVTTELALAGAPMVVGYKTGAITYAIL
RRLMKPKWVTLFNIAAGKAVAPELLQDACDGEGLAREVGKLLDDPALRARQAAEQSVALD
KMGRGMPDPSEAAADALLGFLKAHGQGG

Enzyme Prediction     

No EC number prediction in MGYG000001261_01840.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	4.7e-107	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	5.18e-148	1	383	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	1.24e-120	1	382	1	376	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	5.42e-86	4	344	1	341	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.31e-66	4	380	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.05e-49	1	334	1	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATC31796.1	1.06e-230	2	386	9	393
AAK23884.1	4.81e-227	2	385	9	392
QXZ50297.1	4.81e-227	2	385	9	392
ATC28783.1	4.81e-227	2	385	9	392
ACL95451.1	4.81e-227	2	385	9	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.45e-47	2	342	7	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.45e-47	2	342	7	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6IST7	2.22e-85	2	381	4	383	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
Q2W4D7	2.85e-83	4	382	3	382	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
Q1QMM4	4.05e-75	3	383	12	391	Lipid-A-disaccharide synthase OS=Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14) OX=323097 GN=lpxB PE=3 SV=1
Q5LSU1	1.31e-74	1	381	16	399	Lipid-A-disaccharide synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=lpxB PE=3 SV=1
Q2IW93	4.58e-73	3	384	13	393	Lipid-A-disaccharide synthase OS=Rhodopseudomonas palustris (strain HaA2) OX=316058 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001261_01840.