CAZyme Information: MGYG000001261_02439

Basic Information

• Species: Caulobacter sp903900155
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Caulobacterales; Caulobacteraceae; Caulobacter; Caulobacter sp903900155
• CAZyme ID: MGYG000001261_02439
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		45478.26	7.1454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001261	5012197	MAG	Italy	Europe

• Gene Location: Start: 8076; End: 9335 Strand: -

Full Sequence      

MAMMAVPAAVGAAVIGKNQPARSLTAERLTELPAAQRAAWAAYIKRSQTQMQTDKAILAA
ELPAGQTPPPPPEAGSGHMPLDKDAAWYASAEARAIADTIVSFQTPAGGWSKNQDRIKPP
RLKGQRYANNAEHMALDDSFDTPTDRFWTFVGTLDNGATTTEMRFLAKVQQQAPGKEGDA
YRASILKGVNYLLAAQYPNGGWPQIYPIEGGFHDAVTFNDNAVAEAAMILEDVAEAKEGF
DFASPALRKTAGAASARAIRPILDAQVVVGGKRTVWPQQVDPLTLKPNSARDYEMRSLAS
AESTDILLFLMRQPNPTPEVKASVHAGVAWLKAHAVRDKAFTKVSDEEGRKLVDKPGAPV
IWSRNYDIATGQPIFGDWGKTIHDDVNEISKGRRNGYSWYSSGPQKALDAYEQWAPSHP

Enzyme Prediction     

No EC number prediction in MGYG000001261_02439.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	104	406	2.4e-104	0.9930555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02474	pec_lyase	1.10e-114	104	408	1	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam09492	Pec_lyase	3.96e-98	104	408	1	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF82548.1	5.18e-224	7	419	17	430
ADU15225.1	2.14e-222	7	418	23	435
QYF88206.1	1.84e-182	12	419	26	434
QAY77463.1	6.52e-181	1	419	15	435
QFU31364.1	1.84e-175	1	415	18	431

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	3.27e-141	13	414	1	404	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	6.63e-45	97	399	37	314	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	9.63e-44	97	399	37	314	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999152	0.000890	0.000004	0.000002	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001261_02439.