CAZyme Information: MGYG000001261_03468

Basic Information

• Species: Caulobacter sp903900155
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Caulobacterales; Caulobacteraceae; Caulobacter; Caulobacter sp903900155
• CAZyme ID: MGYG000001261_03468
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		39864.36	7.0089

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001261	5012197	MAG	Italy	Europe

• Gene Location: Start: 3; End: 1073 Strand: +

Full Sequence      

MTTKITRRSAIASALALTACSQGAKSQPAVTPPPPLRTLTPFPIGCCVQERWLHEPEYAD
LLGEQFSQLTAEWEMKMEYILREDGGFKFDRPDSIASFAKARDMALHGHALIWYANENDA
FKRLDGRGKPFADAYRNYILAVVGRYRGQARSWDVVNEPIADDGERLRDCLWSRNLGVDD
HIALALEHAHEADPNAVLFLNDYHLELKPNKRATFMRLIERLLKRGAPLSGIGTQTHIDY
DLPQGAVAEALRDLASFGLPIHLSELDISLGDHYLPALPGDRVKRQVAKYAEVAEAFMAL
PARQRFAFTIWGLRDDNTWLRGNSGQRPKDQPLLFDEAGKAKATCRALADVFGQRG

Enzyme Prediction     

No EC number prediction in MGYG000001261_03468.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	41	350	2.5e-80	0.9603960396039604

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3693	XynA	5.29e-104	66	351	58	340	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
pfam00331	Glyco_hydro_10	5.30e-86	43	350	11	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	5.18e-85	75	344	1	259	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS20276.1	6.88e-150	4	351	3	354
AZH14072.1	1.85e-141	4	351	3	349
ATC25929.1	1.85e-141	4	351	3	349
ACL96602.1	1.50e-140	4	351	3	349
ATC29873.1	1.50e-140	4	351	3	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQW_A	4.26e-54	42	353	14	331	ChainA, Beta-xylanase [Thermobacillus composti]
2Q8X_A	3.58e-51	61	342	33	322	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
1N82_A	3.58e-51	61	342	33	322	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
7NL2_A	1.69e-50	39	337	17	326	ChainA, Beta-xylanase [Pseudothermotoga thermarum DSM 5069],7NL2_B Chain B, Beta-xylanase [Pseudothermotoga thermarum DSM 5069]
3MUI_A	2.76e-50	61	342	33	322	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUI_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45703	1.83e-46	42	342	16	321	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
O69231	1.04e-45	42	336	16	316	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
O69230	1.95e-43	42	350	379	709	Endo-1,4-beta-xylanase C OS=Paenibacillus barcinonensis OX=198119 GN=xynC PE=1 SV=1
P40944	1.06e-42	42	350	364	677	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor sp. (strain Rt8B.4) OX=28238 GN=xynA PE=3 SV=1
Q59675	3.52e-42	36	350	251	595	Endo-beta-1,4-xylanase Xyn10C OS=Cellvibrio japonicus OX=155077 GN=xyn10C PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000165	0.000668	0.795381	0.005137	0.198651	0.000006

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001261_03468.