CAZyme Information: MGYG000001261_03716

Basic Information

• Species: Caulobacter sp903900155
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Caulobacterales; Caulobacteraceae; Caulobacter; Caulobacter sp903900155
• CAZyme ID: MGYG000001261_03716
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467		52191.87	7.2462

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001261	5012197	MAG	Italy	Europe

• Gene Location: Start: 3355; End: 4758 Strand: -

Full Sequence      

MFFWETVVHDHSYVIGGNSEFEHFGKPRQLSTRLGQQTCECCNSYNMLKLTRHLHAWTGE
SRYFDFYERAHLNHILSQQDPDTGMFTYFSPLASGYARGHSTPTDSFWCCVGAGMENYAK
LGDSVFWRDGERVRVNLYYPATLDWVEKGVKFEIDTDFPYGDQVTLTLAKAKAPTPVSLR
IPSWCATPSVKINGQARTTTPKNGYVDLTLRAGDKATLTLPMSVRTESMPDDPGLIAFLN
GPLVLAADLGPADQPWDSFDPVVVGSPVLASANGPQRFSLADYSRPMNLALRPYFEQHHN
RTAVYFRRLTPAQWNEAEPRLVAEAKVRADIRDRTVDIIRFGEQQPEVDHALKASTGTQD
TGNLTVRSRILNKGSIAFQMATAPGPLTLQVSYDGSPRNKDFRILLDGQEVAREKLSGER
TSTLNVRTYALPQALTDGKSKVTVTFEMAANQWTAVFEARVFRAISA

Enzyme Prediction     

No EC number prediction in MGYG000001261_03716.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	2	246	1.8e-94	0.49502982107355864

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.93e-96	1	246	252	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	8.36e-83	2	255	255	510	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOF97816.1	1.55e-178	2	464	306	767
QOT71561.1	6.40e-175	2	463	306	766
AJR24483.1	1.28e-174	2	463	306	766
QDC38918.1	1.28e-174	2	463	306	766
BBF80051.1	3.36e-174	2	464	292	753

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.22e-68	2	463	298	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.15e-65	2	463	298	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	8.16e-15	4	244	296	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	5.91e-14	4	244	296	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.74e-12	4	248	278	547	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.971244	0.028320	0.000253	0.000056	0.000034	0.000096

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001261_03716.