CAZyme Information: MGYG000001262_00241

Basic Information

• Species: Sphingomonas ginsenosidimutans
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales; Sphingomonadaceae; Sphingomonas; Sphingomonas ginsenosidimutans
• CAZyme ID: MGYG000001262_00241
• CAZy Family: GH103
• CAZyme Description: Tn3 family transposase TnXax1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		38548.88	9.9021

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001262	3667136	MAG	Italy	Europe

• Gene Location: Start: 55952; End: 57025 Strand: -

Full Sequence      

MKGVAPLARRLRAALLVMTVLTGGALAGAGPVAAQDVGTDEQAGFQTYLQQVRGRAIAAG
VKPATVDAVLPTLTFNPRVVALDRQQPETAPNAPISMFAPYRAAHVDAARIGRGRTTYAA
QRSRLANVEAQTGVPEQIMVAIWGHETNYGSYTGNFDLLRSLASLAYEGRRRPLFEGEFI
AAMKMIDRGVPRAQLLGSWAGATGNPQFLPSVYLRLARDGDGDGRADIWNSAADTLASIG
NYFAMAGWRAGEPWGVAVSVPATFDRGEVRNRLVSPRCPRVFQRHSGWRTMAEWRALGMV
PESGSWPADRVQATLIEPDGPGRTAYLLTSNYRVILDYNCSNFYALSVGLLADAIAR

Enzyme Prediction     

No EC number prediction in MGYG000001262_00241.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	45	355	2.8e-99	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13406	SLT_2	3.03e-124	44	353	1	292	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
TIGR02283	MltB_2	6.98e-107	44	356	1	299	lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG2951	MltB	2.89e-87	17	357	13	337	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
PRK10760	PRK10760	2.16e-30	82	357	95	355	murein hydrolase B; Provisional
cd13399	Slt35-like	1.51e-14	133	252	2	78	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKS00945.1	1.12e-190	16	357	5	344
QXT37583.1	8.62e-188	29	356	11	333
APX65906.1	9.74e-188	29	356	24	346
QNE31222.1	7.32e-185	30	357	19	346
BCI70058.1	1.17e-184	26	356	4	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ANZ_A	4.36e-64	28	354	27	342	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]
5AO8_A	4.36e-64	28	354	27	342	CrystalStructure of SltB3 from Pseudomonas aeruginosa in complex with NAG-NAM-pentapeptide [Pseudomonas aeruginosa]
5O8X_A	7.21e-29	95	357	50	301	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	9.92e-29	95	357	67	318	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
1LTM_A	1.84e-22	82	356	54	315	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	1.74e-21	82	356	95	356	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002339	0.983467	0.011836	0.001759	0.000307	0.000233

TMHMM  Annotations     

start	end
13	35