CAZyme Information: MGYG000001262_00410

Basic Information

• Species: Sphingomonas ginsenosidimutans
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales; Sphingomonadaceae; Sphingomonas; Sphingomonas ginsenosidimutans
• CAZyme ID: MGYG000001262_00410
• CAZy Family: AA6
• CAZyme Description: NAD(P)H dehydrogenase (quinone)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200		20936.6	6.3796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001262	3667136	MAG	Italy	Europe

• Gene Location: Start: 5664; End: 6266 Strand: -

Full Sequence      

MAKVLVLYYSSYGHIEKMADAVAEGARAGGAEVEIRRVAETAPDEVVKAAGFKTDTAHPL
IEGPDALANYDAIIVGAPTRYGRMPSQMAAFWDTTGGVWMRGALIGKVGGAFTSTASQHG
GQETTLFSIITNLLHHGMAIVGLDYGFQGQMGVKEVHGGTPYGASTLADGDGSRQPSQVD
LDGARHQGKRIAETAAKLFG

Enzyme Prediction     

No EC number prediction in MGYG000001262_00410.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA6	3	197	6.3e-81	0.9948717948717949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK03767	PRK03767	5.43e-121	1	200	1	200	NAD(P)H:quinone oxidoreductase; Provisional
TIGR01755	flav_wrbA	4.06e-96	2	198	1	197	NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR (SP:P03032) are not detected. [Energy metabolism, Electron transport]
COG0655	WrbA	1.32e-55	1	198	3	205	Multimeric flavodoxin WrbA [Energy production and conversion].
pfam03358	FMN_red	1.63e-10	3	142	2	140	NADPH-dependent FMN reductase.
COG0426	NorV	1.53e-09	2	193	247	388	Flavorubredoxin [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAM82206.1	3.22e-59	3	198	4	200
CCE82543.1	1.25e-55	3	199	2	201
QHO31593.1	2.16e-55	3	198	4	199
QHN95894.1	2.16e-55	3	198	4	199
CAG86707.1	4.08e-55	3	200	4	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F4B_A	1.59e-75	1	200	4	202	Structureof B. abortus WrbA-related protein A (WrpA) [Brucella abortus 2308],5F4B_B Structure of B. abortus WrbA-related protein A (WrpA) [Brucella abortus 2308]
5F51_A	2.77e-75	1	200	21	219	Structureof B. abortus WrbA-related protein A (apo) [Brucella abortus 2308]
2R96_A	8.93e-67	1	200	1	198	Crystalstructure of E. coli WrbA in complex with FMN [Escherichia coli],2R96_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_A Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2RG1_A Crystal structure of E. coli WrbA apoprotein [Escherichia coli],2RG1_B Crystal structure of E. coli WrbA apoprotein [Escherichia coli],3B6I_A WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6I_B WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6J_A WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6J_B WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6K_A WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6K_B WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6M_A WrbA from Escherichia coli, second crystal form [Escherichia coli K-12],3B6M_B WrbA from Escherichia coli, second crystal form [Escherichia coli K-12]
4LA4_A	3.40e-66	3	198	4	203	Crystalstructure of native PnpB [Pseudomonas sp. WBC-3],4LA4_B Crystal structure of native PnpB [Pseudomonas sp. WBC-3],4LAF_A Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_B Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_C Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_D Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3]
4DY4_A	4.96e-66	2	200	1	197	Highresolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1],4DY4_C High resolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8HRS7	1.21e-97	1	200	1	199	NAD(P)H dehydrogenase (quinone) OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571) OX=438753 GN=AZC_4089 PE=3 SV=1
B2JML0	7.75e-94	1	200	1	199	NAD(P)H dehydrogenase (quinone) OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=Bphy_3669 PE=3 SV=1
B6JBZ6	2.22e-93	1	200	1	199	NAD(P)H dehydrogenase (quinone) OS=Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) OX=504832 GN=OCAR_5077 PE=3 SV=1
Q3SU01	2.22e-93	1	200	1	199	NAD(P)H dehydrogenase (quinone) OS=Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255) OX=323098 GN=Nwi_0978 PE=3 SV=1
Q9AA17	1.82e-92	1	200	1	199	NAD(P)H dehydrogenase (quinone) OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=CC_0791 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001262_00410.