CAZyme Information: MGYG000001262_00830

Basic Information

• Species: Sphingomonas ginsenosidimutans
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales; Sphingomonadaceae; Sphingomonas; Sphingomonas ginsenosidimutans
• CAZyme ID: MGYG000001262_00830
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334		35292.73	4.8931

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001262	3667136	MAG	Italy	Europe

• Gene Location: Start: 4004; End: 5008 Strand: +

Full Sequence      

MKPVIFGLSGPSLTDAERAFFRAARPAGYILFKRNVETRAQLRALTDSLRELEGRDDVAI
LVDQEGGPVARLAPPEWPAFPAGPAFDRLYEIAPMSAIEAARANAHALGLMLADMGITVD
CHPILDVARAGTTEAIAIRAFGHDPMRVAAIGRATMEGLIAGGVVPVVKHMPGHGRALLD
SHFALPTVTADAAALEEDLAPFRALAHAPMGMTTHIVFEAWDRDRPATLSPVVIEEVIRG
RIGFDGLLMSDDLDMKALSGTPAEKAAGAIAAGCDVVLECHAPIPEMEAIVAGLDDMAPP
SRARLDRAMAGRTPAAGDMAGLIDTRDRLLALAE

Enzyme Prediction     

No EC number prediction in MGYG000001262_00830.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	59	278	2.3e-41	0.9398148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.01e-63	1	308	5	304	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	1.89e-54	1	334	1	328	beta-hexosaminidase; Provisional
pfam00933	Glyco_hydro_3	1.37e-42	27	291	33	296	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKS01235.1	1.64e-177	1	334	1	334
QNE30531.1	4.70e-170	1	333	1	333
AXJ96044.1	4.59e-165	1	333	1	333
BCA62158.1	9.68e-160	1	331	1	331
QBM76359.1	1.04e-159	1	332	1	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4G6C_A	1.77e-44	3	315	13	324	Crystalstructure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315],4G6C_B Crystal structure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315]
4GNV_A	1.85e-44	3	315	15	326	Crystalstructure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 with bound N-Acetyl-D-Glucosamine [Burkholderia cenocepacia J2315],4GNV_B Crystal structure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 with bound N-Acetyl-D-Glucosamine [Burkholderia cenocepacia J2315],4MSS_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-acetamido-4,5,6-trihydroxyazepane [Burkholderia cenocepacia J2315],4MSS_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-acetamido-4,5,6-trihydroxyazepane [Burkholderia cenocepacia J2315],5UTP_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to N-ethylbutyryl-PUGNAc [Burkholderia cenocepacia],5UTP_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to N-ethylbutyryl-PUGNAc [Burkholderia cenocepacia],5UTQ_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to PUGNAc [Burkholderia cenocepacia],5UTQ_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to PUGNAc [Burkholderia cenocepacia],5UTR_A Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-butyryl-4,5,6-trihydroxyazepane [Burkholderia cenocepacia],5UTR_B Crystal structure of Burkholderia cenocepacia family 3 glycoside hydrolase (NagZ) bound to (3S,4R,5R,6S)-3-butyryl-4,5,6-trihydroxyazepane [Burkholderia cenocepacia],6DTE_A GlcNAc-inspired cyclophellitol bound to NagZ [Burkholderia cenocepacia],6DTE_B GlcNAc-inspired cyclophellitol bound to NagZ [Burkholderia cenocepacia]
7VI6_A	2.51e-43	1	292	1	289	ChainA, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI6_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_A Chain A, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835]
3TEV_A	2.34e-40	8	318	26	336	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]
6K5J_A	2.03e-34	4	281	21	300	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7NWB7	1.48e-45	3	333	7	336	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1
Q0A911	3.30e-45	3	307	5	309	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1
Q2KXM7	3.68e-44	3	283	14	296	Beta-hexosaminidase OS=Bordetella avium (strain 197N) OX=360910 GN=nagZ PE=3 SV=1
Q5P081	1.63e-43	3	320	16	334	Beta-hexosaminidase OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=nagZ PE=3 SV=1
Q606N2	2.41e-39	5	334	1	318	Beta-hexosaminidase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001262_00830.