CAZyme Information: MGYG000001262_00833

Basic Information

• Species: Sphingomonas ginsenosidimutans
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales; Sphingomonadaceae; Sphingomonas; Sphingomonas ginsenosidimutans
• CAZyme ID: MGYG000001262_00833
• CAZy Family: CBM85
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467		50227.49	7.0214

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001262	3667136	MAG	Italy	Europe

• Gene Location: Start: 6825; End: 8228 Strand: +

Full Sequence      

MRRTQPCAAILSALAWAMAAPSVAQQGTDILSYAVNDVSAGWVPYGSNHKARAIDDAGVQ
GGRAIRIELKAPGAHPWDDGANVPITRAVAKGDPLVFAFWARAPKAAAGERVTLPFAGIT
QSHAPYDQVLKGAPTIGRDWAMVELRGVADRDYPAGELQASLQLSVANLTVDLGPAFVLD
LKRKAGAATAAAASAAPPASTAHAMGATNQEAHRPMAVPAGRPTWADEFDGAAIDAANWR
FDTARNAAGWYNNERQYYADGRPENARIEKGALVIEARRETLPKARFADWGGQDYTSARM
VTRRTLGYGFYEVRATLPCGRGIWPAIWLLPPDGAWPDAGEIDIMEMVGSEPEMSHATVH
SAAYNHASNSQRGAQTRVTGACTAAHDYQLDWQPDAITIGVDGRSYMRVERKPGDGMREW
PFTRAYNLILNVAVGGDWAGAKGIDDTAFLQRMTVEHVRFWGAPAAK

Enzyme Prediction     

No EC number prediction in MGYG000001262_00833.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	225	461	2.2e-69	0.9956521739130435
CBM85	52	180	3.4e-31	0.9696969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	4.08e-80	225	461	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	1.82e-29	227	461	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08024	GH16_CCF	3.43e-28	225	437	3	277	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd02182	GH16_Strep_laminarinase_like	7.15e-27	224	443	5	239	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
pfam00722	Glyco_hydro_16	3.52e-24	263	459	3	168	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNQ08743.1	5.95e-129	207	463	15	271
BCA61341.1	1.74e-125	199	461	7	269
APR53903.1	2.46e-123	205	466	14	273
QDZ08756.1	1.10e-121	205	461	7	261
QCB44215.1	6.21e-119	205	463	4	260

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XOF_A	6.82e-82	213	461	15	266	ChainA, GH16 family protein [uncultured bacterium]
6XQF_A	3.82e-81	213	461	15	266	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]
3ILN_A	1.12e-64	225	461	9	247	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
2HYK_A	1.85e-45	225	461	11	242	Thecrystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
3ATG_A	3.65e-44	225	461	7	238	endo-1,3-beta-glucanasefrom Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45798	6.99e-63	225	461	44	282	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
C1IE32	1.24e-36	225	461	24	267	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
Q27082	3.95e-28	219	461	23	252	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
P23903	1.39e-26	225	461	427	679	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q9ZG90	1.45e-23	225	464	60	290	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001772	0.996473	0.000493	0.000525	0.000381	0.000324

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001262_00833.