CAZyme Information: MGYG000001262_00997

Basic Information

• Species: Sphingomonas ginsenosidimutans
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales; Sphingomonadaceae; Sphingomonas; Sphingomonas ginsenosidimutans
• CAZyme ID: MGYG000001262_00997
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000001262_26|CGC1	39594.78	6.2265

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001262	3667136	MAG	Italy	Europe

• Gene Location: Start: 3262; End: 4347 Strand: -

Full Sequence      

MTATPPSTRPDLGMIEGRFGRLWTADERSHVVATLAGVGYSFYHYGPKGDRALRRDWRVA
HDPAQTRALARLSAQVRGAGMRFGIALTPDGSTHPFDDAARADLARRIADLDAIGIDDLA
ILFDDLRGDMPDLAARQADVVNFCAAATRATRVYTCPTYYSDDPVLDMVFTPRPADYLGD
LGRRLDPAIRVYWTGEEVCPKEIGPAHLARVADELGRPVCLWDNWPVNDGARMSRFLHLR
AFTGRAAANAAHLSGHAINPAIQAHLGCIPALTLPMIYDQGADYAYGAAFAAAAERLLGQ
PFAHMLQQDLIALQDTGHERLGTRAAKLRDRYAAIDHPAAREIIRWLDGDDLMTDAEVQT
Q

Enzyme Prediction     

No EC number prediction in MGYG000001262_00997.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	13	304	1.8e-63	0.9694915254237289

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	3.27e-45	13	264	2	248	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSR19128.1	2.05e-208	10	361	3	354
QDK34839.1	2.05e-208	10	361	3	354
QCI96148.1	2.64e-204	10	361	3	354
QCI95650.1	2.64e-204	10	361	3	354
AXB79718.1	5.24e-203	10	361	8	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XSA_A	1.91e-35	13	293	4	287	ChainA, Hyaluronoglucosaminidase [Oceanicola granulosus HTCC2516],2XSB_A Chain A, Hyaluronoglucosaminidase [Oceanicola granulosus HTCC2516]
7KHS_A	1.97e-35	13	293	6	289	ChainA, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_B Chain B, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_C Chain C, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_D Chain D, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516]
5DIY_A	1.60e-31	13	300	8	298	Thermobaculumterrenum O-GlcNAc hydrolase mutant - D120N [Thermobaculum terrenum],5DIY_B Thermobaculum terrenum O-GlcNAc hydrolase mutant - D120N [Thermobaculum terrenum]
5UHK_A	1.21e-16	13	260	8	259	Crystalstructure of the core catalytic domain of Human O-GlcNAcase [Homo sapiens],5UHK_C Crystal structure of the core catalytic domain of Human O-GlcNAcase [Homo sapiens],5UHL_A Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with Thiamet G [Homo sapiens],5UHL_C Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with Thiamet G [Homo sapiens],5UHO_A Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with PUGNAc [Homo sapiens],5UHO_C Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with PUGNAc [Homo sapiens]
5UHP_A	1.67e-16	13	260	51	302	Crystalstructure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],5UHP_B Crystal structure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],5UHP_C Crystal structure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],5UHP_D Crystal structure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],6PM9_A Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens],6PM9_B Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens],6PM9_C Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens],6PM9_D Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2CEE3	1.05e-34	13	293	4	287	Protein O-GlcNAcase OS=Oceanicola granulosus (strain ATCC BAA-861 / DSM 15982 / KCTC 12143 / HTCC2516) OX=314256 GN=OG2516_04129 PE=1 SV=1
Q8VIJ5	1.53e-15	13	260	63	314	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1
O60502	2.05e-15	13	260	63	314	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2
Q9EQQ9	2.05e-15	13	260	63	314	Protein O-GlcNAcase OS=Mus musculus OX=10090 GN=Oga PE=1 SV=2
Q89ZI2	8.20e-14	13	260	152	394	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001262_00997.