CAZyme Information: MGYG000001262_02593

Basic Information

• Species: Sphingomonas ginsenosidimutans
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales; Sphingomonadaceae; Sphingomonas; Sphingomonas ginsenosidimutans
• CAZyme ID: MGYG000001262_02593
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		44488.76	9.7823

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001262	3667136	MAG	Italy	Europe

• Gene Location: Start: 3614; End: 4840 Strand: -

Full Sequence      

MRRNVDNPWIAGPAVALLAWAIFLFRVTVPAQLVFDEVHYVRAARVLLTLSGPENVEHPL
LGKELIAAGMLIFGDTPLGWRFMSTVAGGATIGGVFALTRVLTQRTPPALLAATLALLGF
TVYVQARIAMLDTFMLAFVIAGIALIAASARSGSMASWAIGAAMLGCATACKWSAAPYVA
AAAVAFLAMRRGRTDRWPGMRALPAIATLGAVSVGVYFLTFAPAFLYANDALTPARLLAF
QWEMYQRQTLVLPPHTYQAAWYTWPLMLRPIWYLYEPVDGVQRGILMIGNPAVMWGGLIA
VAACLYGWIRTGSARLLAPAMLWALALGMFAVIPKSLGFYYYYYPAGVFLSVALAVAIDH
WRAALGEWVEVYLLVAFALALYFLPVLSAEPLAHAGAFSRWTWFARWV

Enzyme Prediction     

No EC number prediction in MGYG000001262_02593.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	15	224	8e-41	0.9865470852017937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	1.11e-09	241	384	7	169	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG4346	COG4346	3.35e-07	55	306	133	356	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	5.02e-07	13	173	28	210	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	2.35e-06	253	408	517	694	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	0.002	14	173	2	183	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNE33405.1	7.00e-158	15	408	12	405
QKS01241.1	2.02e-150	1	408	5	417
QXT37722.1	4.22e-144	1	407	1	413
QBE93459.1	4.22e-144	6	407	9	413
BCI72312.1	4.22e-144	6	407	9	413

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	9.80e-17	9	308	44	411	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	9.80e-17	9	308	44	411	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	2.37e-13	34	308	66	402	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	1.71e-10	9	141	38	182	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
80	102
128	150
160	182
203	225
287	309
316	334
339	358
371	393