CAZyme Information: MGYG000001263_01811

Basic Information

• Species: Acidovorax sp000302535
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Acidovorax; Acidovorax sp000302535
• CAZyme ID: MGYG000001263_01811
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
284	MGYG000001263_57|CGC1	30953.33	9.8349

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001263	5662192	MAG	Italy	Europe

• Gene Location: Start: 9483; End: 10337 Strand: -

Full Sequence      

MTSFRQIGRLRWYVLGCLLCFLQQTARADLWAHVDERGVTHFAAEQVDARYQLFFRGNDF
DSTRDAPANASPLPYALPAAGARLLAFFDIAPDYKRVKHHLRAASTQHGVDYELLQAVIA
TESGFDAAAVSPKGAVGLMQVMPATASRFGVSADKKRTVEQKLADPAVNVPTGTRYLRHL
LDLFPGRMDLAVAAYNAGEGAVQKAGNQVPAFKETQNYVRTVLGLYAQLKPPAPVLTQRA
LPGRVRMELSGGAQNRGNLPPTQVAQTRSAPQTAFEPLPTIPNE

Enzyme Prediction     

No EC number prediction in MGYG000001263_01811.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	112	228	3.9e-31	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.43e-43	113	227	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	1.22e-41	102	226	9	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.42e-39	102	223	11	143	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.33e-32	102	213	2	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	4.93e-30	102	205	2	102	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFU45312.1	7.24e-204	1	284	1	284
QLA80715.1	1.55e-169	10	268	7	265
AYM95622.1	2.03e-159	1	284	1	281
ART50185.1	1.44e-142	2	279	3	276
AOG21394.1	4.76e-142	11	284	10	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	1.16e-11	101	202	178	288	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	2.84e-11	101	202	178	288	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
6FBT_A	8.38e-10	109	236	461	603	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	8.55e-10	109	236	490	632	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	2.02e-09	109	236	462	604	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.33e-28	101	226	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	1.54e-22	100	228	1425	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	1.54e-22	100	228	1425	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
C5A0N2	6.84e-11	101	202	196	306	Membrane-bound lytic murein transglycosylase C OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=mltC PE=3 SV=1
P0C066	6.84e-11	101	202	196	306	Membrane-bound lytic murein transglycosylase C OS=Escherichia coli (strain K12) OX=83333 GN=mltC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000730	0.997325	0.001318	0.000209	0.000200	0.000200

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001263_01811.