CAZyme Information: MGYG000001263_02412

Basic Information

• Species: Acidovorax sp000302535
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Acidovorax; Acidovorax sp000302535
• CAZyme ID: MGYG000001263_02412
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387		42429.51	8.188

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001263	5662192	MAG	Italy	Europe

• Gene Location: Start: 15741; End: 16904 Strand: +

Full Sequence      

MADSPRVAMVAGETSGDLLAGLLIDGMQAHWPGLQSSGIGGPQMARRGFTAWWPCDKLAV
HGYSMEVLRRLRELLGIRKQLRERLLKDRPDVFIGVDAPDFNLGLEADLRAAGIKTVHFV
CPSIWAWRADRVEKIRRSADHVLCIFPFEPELLAQHGIAATYVGHPLAGVIPMVPDRTAA
RAQLGLRDEDEVLAILPGSRSSEIQYIARPFFEAAALVLKARPAIKLIVPAVPALRDRIE
QVARACGLGDALQITTGQSHTVLAACDATLIASGTATLEAALFKRPMVIGYHMHPLSWWL
MRRKQLQPWVGLPNILCREFVVPELIQDAATPQALCAATLDWLDAKRQDPPKIAALEQRF
TALHESLLRNTPQLAADAIQKILAPAA

Enzyme Prediction     

No EC number prediction in MGYG000001263_02412.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	7	367	3.4e-125	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.37e-164	4	383	1	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.37e-140	5	383	2	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.95e-109	7	379	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	8.51e-99	5	384	6	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	7.93e-45	11	326	233	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFU45535.1	5.91e-280	1	387	1	387
QLA80541.1	9.23e-252	1	387	1	387
ART52367.1	1.51e-245	5	384	5	384
ART48838.1	1.51e-245	5	384	5	384
ART54693.1	4.33e-245	5	384	5	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.50e-88	7	382	9	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.53e-88	7	382	9	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1WHV5	4.05e-222	6	384	10	388	Lipid-A-disaccharide synthase OS=Verminephrobacter eiseniae (strain EF01-2) OX=391735 GN=lpxB PE=3 SV=1
Q21WX7	1.11e-198	6	383	10	387	Lipid-A-disaccharide synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) OX=338969 GN=lpxB PE=3 SV=1
A1K6Q8	1.35e-127	4	387	2	382	Lipid-A-disaccharide synthase OS=Azoarcus sp. (strain BH72) OX=418699 GN=lpxB PE=3 SV=1
Q13XC9	3.82e-124	6	383	9	382	Lipid-A-disaccharide synthase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=lpxB PE=3 SV=1
Q7WA47	6.19e-124	4	382	2	388	Lipid-A-disaccharide synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) OX=257311 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001263_02412.