CAZyme Information: MGYG000001263_02491

Basic Information

• Species: Acidovorax sp000302535
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Acidovorax; Acidovorax sp000302535
• CAZyme ID: MGYG000001263_02491
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265		29200.61	8.4039

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001263	5662192	MAG	Italy	Europe

• Gene Location: Start: 2242; End: 3039 Strand: +

Full Sequence      

MRDQAFRKHAWLLCLPMLVSTPTAQAQDQLVDLQSSGGYTSYRLADDVTQVDLVEQTQGT
CRFNRTWGYDLTNRELWTNGGCGGRFKITRTYASGNISGSNAGAAVAAVAAIAGIALLAN
HNRHDDDRRPEYPGYPGQGGDWGREIRVDGRLCLDVRGGKFQPGTTLQVYECNGTASQRF
TVGRGGEIRVRDLCVDVDRGDPRDGARVVLWSCSGSRSQSWFTRGGQIVSQLTGKCLDVD
AGQVRPGAHTMVWPCNRSPSQRWWW

Enzyme Prediction     

No EC number prediction in MGYG000001263_02491.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	150	264	8.4e-22	0.6276595744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF035930	lectin_2	1.03e-121	29	263	1	238	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
pfam00652	Ricin_B_lectin	3.58e-20	145	263	4	126	Ricin-type beta-trefoil lectin domain.
NF035929	lectin_1	2.12e-19	148	263	718	834	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
cd00161	RICIN	1.55e-18	146	265	5	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
smart00458	RICIN	5.44e-15	145	265	1	117	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFU46703.1	2.79e-106	1	235	1	235
QLA79528.1	2.57e-92	1	235	1	235
ANH70697.1	1.26e-33	24	230	20	235
QPF76441.1	2.15e-32	18	232	9	228
QFS65516.1	3.47e-31	12	235	10	250

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000389	0.998865	0.000202	0.000211	0.000158	0.000151

TMHMM  Annotations     

start	end
97	119