CAZyme Information: MGYG000001263_03721

Basic Information

• Species: Acidovorax sp000302535
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Acidovorax; Acidovorax sp000302535
• CAZyme ID: MGYG000001263_03721
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235	MGYG000001263_184|CGC1	25866.66	10.4219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001263	5662192	MAG	Italy	Europe

• Gene Location: Start: 5685; End: 6392 Strand: +

Full Sequence      

MSKRGAILNPPWAAAAGGPGGVSRRGCLVSLASLAAPAAWLGAPQVAHAGGQLEEPLMDS
VRTALSSAIANQAPPEPEFFTTEARLHYLRWLGTQSDRLRPRKPDLEVRRDFLQTVWYES
KRAGLDVSLVLGLIQVESGFRKFAVSSVGARGYMQVMPFWTRVIGDGDPGKLFHMQTNLR
FGCVILRHYIDREQGDLFMALGRYNGSRGRSPYPDAVFAAQRKWLFADRPQSPAA

Enzyme Prediction     

No EC number prediction in MGYG000001263_03721.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	117	210	9.5e-18	0.6888888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	6.62e-26	128	210	2	84	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	2.99e-23	114	225	6	113	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.47e-18	120	210	5	98	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	1.95e-17	110	235	4	124	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	2.26e-17	68	224	94	257	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFU44643.1	1.29e-168	1	235	1	235
ART50223.1	9.70e-135	18	230	6	215
QLA83112.1	2.11e-134	20	235	18	230
QNP59119.1	7.65e-132	18	226	10	218
ART54348.1	8.43e-132	21	230	2	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	8.32e-08	54	219	376	533	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	8.34e-08	54	219	380	537	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	8.37e-08	54	219	386	543	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	8.38e-08	54	219	390	547	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	8.41e-08	54	219	396	553	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.96e-09	124	209	72	154	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
B8F6F0	2.74e-07	106	186	189	278	Membrane-bound lytic murein transglycosylase C OS=Glaesserella parasuis serovar 5 (strain SH0165) OX=557723 GN=mltC PE=3 SV=1
A3N339	6.70e-07	106	186	190	279	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) OX=416269 GN=mltC PE=3 SV=1
B0BSH0	6.70e-07	106	186	190	279	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) OX=434271 GN=mltC PE=3 SV=1
B3GYW8	6.70e-07	106	186	190	279	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) OX=537457 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000124	0.000919	0.000037	0.956220	0.042676	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001263_03721.