CAZyme Information: MGYG000001263_04506

Basic Information

• Species: Acidovorax sp000302535
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Acidovorax; Acidovorax sp000302535
• CAZyme ID: MGYG000001263_04506
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244		27056.26	10.6724

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001263	5662192	MAG	Italy	Europe

• Gene Location: Start: 2613; End: 3347 Strand: +

Full Sequence      

MKAVLRWLGLLVIAFVALQLFFVLRIAAMAAINPESTTFQRSEAWTLLASKGHVPWRQQW
VPYADISDHLKRAVIASEDDGFVNHDGVDWNAIEKAWERNAKAEAQASKAQARAPERPVR
APKIRGGSTITQQLAKNLLLSGERTLLRKGQEFVLTLALEQLLSKQRILEIYLNNVEWGE
GVFGAEAAAQHYFRKSASRLSTAEAARLAVMLPAPKRFEKTPGSAYLAGRTRTILGRMGG
AELP

Enzyme Prediction     

No EC number prediction in MGYG000001263_04506.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	57	238	3.4e-62	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	8.53e-102	6	244	7	229	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	3.64e-82	6	244	2	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	2.03e-70	45	238	2	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	4.51e-68	1	242	14	244	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	5.59e-54	57	238	1	165	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFU47684.1	8.31e-149	1	244	1	244
QLA81299.1	1.56e-137	1	244	1	244
AYM95464.1	1.05e-135	1	244	1	244
AOG21941.1	1.49e-135	1	244	1	244
ART50897.1	1.06e-128	1	244	1	244

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	9.98e-26	60	238	22	183	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	3.86e-25	60	238	22	183	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	9.81e-23	42	238	25	202	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	1.25e-20	61	238	42	202	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
7U4H_A	2.44e-20	61	218	43	181	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q13U46	2.84e-71	13	244	25	239	Biosynthetic peptidoglycan transglycosylase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=mtgA PE=3 SV=1
B2JH09	5.57e-70	12	244	30	245	Biosynthetic peptidoglycan transglycosylase OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=mtgA PE=3 SV=1
A4G8N2	9.85e-70	1	244	4	231	Biosynthetic peptidoglycan transglycosylase OS=Herminiimonas arsenicoxydans OX=204773 GN=mtgA PE=3 SV=1
Q2SZD0	1.53e-69	2	244	24	253	Biosynthetic peptidoglycan transglycosylase OS=Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) OX=271848 GN=mtgA PE=3 SV=1
B2SYS3	3.73e-69	13	244	25	239	Biosynthetic peptidoglycan transglycosylase OS=Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) OX=398527 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000018	0.000006	0.000001	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
7	29