CAZyme Information: MGYG000001263_05127

Basic Information

• Species: Acidovorax sp000302535
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Acidovorax; Acidovorax sp000302535
• CAZyme ID: MGYG000001263_05127
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324		36387.65	9.5639

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001263	5662192	MAG	Italy	Europe

• Gene Location: Start: 1215; End: 2189 Strand: -

Full Sequence      

MHILLVNNSPIPVYGYGGTERVIWDLGKTLVQQGHRVSYLVPEGSTCDFGQVLPIRPDEP
WEGQIPADVDITHFQFNPRSELSKPYLVTEHGNARKPKPLPRNTVFLSRDHAARYGSSEF
VYNGLDWAGYGPVDFDRPRSHYHFLGKAAWGVKNVRGAIKVAKMAGVELDVLGGNRINFK
RGFRWTLSRKIHFHGMVGGTQKTGLLNASRGLIFPVRWHEPFGLAVIESLYFGCPVFSTP
YGALPELVPVHCGVLSDQASVLAEAVRGNRFDPRACHQHVVEHFGAERMARNYLRMYERV
LAGETLNAQPPMIQGPARELPWRQ

Enzyme Prediction     

No EC number prediction in MGYG000001263_05127.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03802	GT4_AviGT4-like	5.43e-75	10	300	11	333	UDP-Glc:tetrahydrobiopterin alpha-glucosyltransferase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. aviGT4 in Streptomyces viridochromogenes has been shown to be involved in biosynthesis of oligosaccharide antibiotic avilamycin A. Inactivation of aviGT4 resulted in a mutant that accumulated a novel avilamycin derivative lacking the terminal eurekanate residue.
cd03801	GT4_PimA-like	4.30e-23	2	298	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.00e-14	1	304	1	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03823	GT4_ExpE7-like	2.99e-14	3	299	2	357	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
pfam13692	Glyco_trans_1_4	4.94e-10	144	267	6	133	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFU44031.1	1.08e-250	1	324	1	324
QLA82362.1	3.70e-233	1	323	1	323
ART56403.1	5.26e-233	1	322	1	322
ART57641.1	5.26e-233	1	322	1	322
ART46883.1	3.97e-228	1	322	1	322

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IUY_A	6.59e-07	11	305	24	340	Crystalstructure of AviGT4, a glycosyltransferase involved in Avilamycin A biosynthesis [Streptomyces viridochromogenes],2IUY_B Crystal structure of AviGT4, a glycosyltransferase involved in Avilamycin A biosynthesis [Streptomyces viridochromogenes]
2IV3_A	1.57e-06	11	305	24	340	Crystalstructure of AviGT4, a glycosyltransferase involved in Avilamycin A biosynthesis [Streptomyces viridochromogenes],2IV3_B Crystal structure of AviGT4, a glycosyltransferase involved in Avilamycin A biosynthesis [Streptomyces viridochromogenes],2IV3_C Crystal structure of AviGT4, a glycosyltransferase involved in Avilamycin A biosynthesis [Streptomyces viridochromogenes],2IV3_D Crystal structure of AviGT4, a glycosyltransferase involved in Avilamycin A biosynthesis [Streptomyces viridochromogenes]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001263_05127.