CAZyme Information: MGYG000001264_00180

Basic Information

• Species: Acidovorax temperans
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Acidovorax; Acidovorax temperans
• CAZyme ID: MGYG000001264_00180
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385		42242.18	8.2783

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001264	3268278	MAG	Italy	Europe

• Gene Location: Start: 16102; End: 17259 Strand: +

Full Sequence      

MASHPRIAMVAGEASGDLLAGLLLDGLQARWPELQAKGIGGPQMARRGFECLWPSEKLAV
HGYSMEVLRRLRELLGIRKQLRDQLLRERPGVFIGVDAPDFNLGLEADLRAAGIKTVHFV
CPSIWAWRAERVEKIRRSADHVLCIFPFEPELLARHGIAATYVGHPLANVIPRVPDRAGA
RAALGFAPEDEVLAILPGSRSAEVQYIAPPFFSAAALIHQARPATKFIVPAVPLLQARIE
QLVRSAGLEGAVRVVTGQSHTVLAACDATLIASGTATLEAALFKRPMVIGYHMHPLSWWL
MRRKQLQPWVGLPNILCGEFVVPELIQDAATPEALCAATLQWLQAREQQPEKIQALEQRF
DALHESLQRNTSQLAAHAIEKVLAA

Enzyme Prediction     

No EC number prediction in MGYG000001264_00180.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	7	368	2.4e-127	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.73e-158	5	383	2	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.06e-132	5	379	2	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.35e-99	7	379	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.92e-95	5	384	6	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	1.60e-41	11	358	233	587	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYM98547.1	1.90e-259	1	384	1	384
QLA80541.1	1.27e-230	1	383	1	383
AFU45535.1	2.10e-229	1	384	1	384
ART52367.1	1.86e-227	5	385	5	385
ART48838.1	1.86e-227	5	385	5	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.66e-82	7	379	9	377	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.34e-82	7	379	9	377	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1WHV5	9.31e-202	6	384	10	388	Lipid-A-disaccharide synthase OS=Verminephrobacter eiseniae (strain EF01-2) OX=391735 GN=lpxB PE=3 SV=1
Q21WX7	3.39e-190	1	383	5	387	Lipid-A-disaccharide synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) OX=338969 GN=lpxB PE=3 SV=1
Q13XC9	1.55e-125	6	383	9	382	Lipid-A-disaccharide synthase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=lpxB PE=3 SV=1
A1K6Q8	1.65e-125	5	379	3	374	Lipid-A-disaccharide synthase OS=Azoarcus sp. (strain BH72) OX=418699 GN=lpxB PE=3 SV=1
B2T5I1	5.78e-123	6	383	9	382	Lipid-A-disaccharide synthase OS=Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) OX=398527 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001264_00180.