CAZyme Information: MGYG000001264_01782

Basic Information

• Species: Acidovorax temperans
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Acidovorax; Acidovorax temperans
• CAZyme ID: MGYG000001264_01782
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288		30493.82	7.3571

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001264	3268278	MAG	Italy	Europe

• Gene Location: Start: 1397; End: 2263 Strand: -

Full Sequence      

MTASGKFVSGLRTFVTDVTNGFLEITHNSFALIGLAVAFVAITLTARPDLRQAGEEQLMN
WLQERQVAAIGMPVEPDASERATAGNPKDLPKEQAAVAFWLSKKYKVAPEPLSVLVAEAY
DIGTRTKLDPTLILAIMAIESNFNPFAQSAVGAQGLMQVMTRVHTEKYQNFGGHFAAFDP
VSNLRVGVKVLQECIARAGSIEGGLRYYVGAANLPDDGGYTAKVMAEHSRLRQVANGRSV
PVNAPVMLSTQAPAATPAQAVPAASRNAGERPSAEADSKVALLGSVGS

Enzyme Prediction     

No EC number prediction in MGYG000001264_01782.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	125	229	1.2e-16	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.52e-18	130	226	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16893	LT_MltC_MltE	4.12e-14	125	187	9	78	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
pfam01464	SLT	2.45e-13	128	199	10	82	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16896	LT_Slt70-like	6.83e-13	125	192	14	85	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.41e-11	109	197	3	92	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYM95730.1	3.49e-171	1	283	1	280
QLA80562.1	1.22e-156	1	283	1	276
ART48859.1	4.61e-156	1	283	1	277
AFU45512.1	5.32e-156	1	283	1	277
ART52383.1	2.66e-155	1	283	1	277

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27380	1.87e-07	123	245	15	132	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
O31976	3.61e-07	123	230	1430	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	3.61e-07	123	230	1430	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999945	0.000068	0.000000	0.000000	0.000000	0.000005

TMHMM  Annotations     

start	end
21	43