CAZyme Information: MGYG000001264_02571

Basic Information

• Species: Acidovorax temperans
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Acidovorax; Acidovorax temperans
• CAZyme ID: MGYG000001264_02571
• CAZy Family: GT51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366		38698.1	11.3707

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001264	3268278	MAG	Italy	Europe

• Gene Location: Start: 2702; End: 3802 Strand: -

Full Sequence      

MSVRTALAASLNVPAVRTLVMVTPDAFHRQLGALGLPLRENGDYFGYSLALGSAEVPLLH
LTNAFRSLANGGRFSPVVVLPTRARPAFTPALDARAAFIVGDILSDGNARARTFGTDSVL
ATRFWSAVKTGTSKDMRDNWAVGWSERYTVGVWVGNAGGAAMHDVSGTSGAAPVWAAVMG
FLHAREPSRPPRPPQGLVQWPVRFGPAGGDGDSATASLPLEAARTEWFVPGTQQSVFAIN
NVASRALSVSAGGQKRSQPAEPQADLGPARILMPVHGTVIALDPDIPPQSQRLRLQTADR
AGPRLAWRMDGKPLGRGAVLEWLPWPGRHTLELVNAQGQVLDTVRFEVRGAGVAPGAVPG
TASKPR

Enzyme Prediction     

No EC number prediction in MGYG000001264_02571.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	4.32e-71	2	348	362	727	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	1.70e-41	2	350	383	733	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	5.15e-29	1	184	342	530	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.21e-24	1	183	412	597	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	8.53e-21	1	233	509	763	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYM98813.1	1.90e-196	2	366	412	775
AFU45110.1	7.22e-173	2	353	414	767
ART53698.1	2.63e-169	2	360	404	760
ART59874.1	2.63e-169	2	360	404	760
QLA83751.1	5.16e-169	2	353	395	762

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	1.50e-07	2	237	558	810	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	2.64e-16	2	338	388	721	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
Q9KUC0	3.50e-08	6	209	532	739	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
O87626	1.45e-07	2	198	512	720	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
P70997	2.43e-07	6	233	421	652	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3
O87579	3.39e-07	2	198	513	721	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001264_02571.