CAZyme Information: MGYG000001265_00623

Basic Information

• Species: Methylobacterium sp002778835
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Methylobacterium; Methylobacterium sp002778835
• CAZyme ID: MGYG000001265_00623
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627	MGYG000001265_17|CGC1	67993	9.1367

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001265	4213059	MAG	Italy	Europe

• Gene Location: Start: 3572; End: 5455 Strand: +

Full Sequence      

MSSSPLLPEAPALEIPAEAPSTRPSGLEAWQRGGRWALLWRRLALAVPTLATGGLIAALA
FSAYEPPRGWLAGSVLALFCLVMAWQSFVAWQYVYGLIATLLGDRALSVLERRSSSVPTR
ASGLSRTAAVVAIHAEDAVAVFAALRVMARSLAREDRRGDDIDLFVLSDTRDGTIAAVEE
HEFARFEAWRRTAGPGIPRIRYRRRQENTGRKAGNIAEFCATYGAEYDFMIVLDADSLMT
GAAMRRLVRLMEESPRVGLIQTVSYAAGRDTLFARIQQFAVRLYAPLALRCLETWQGPDG
SYWGHNAIIRVDAFAQNAQLPVLPGRAPLGGEILCHDIVEGAFLRRSGWEVRLLPEMGGT
WEEMPTNLVDLLGRERRWCQGNLQHLRVLPMAGLLPASRWHLLVGILSYCVLPAWIAFLA
AGTLLAARTGELGLLGYGLTGHGPAALALAALTVAVLALPKLLSLGHVLVSPERRAAFGG
TASLLKSAALEQLVWVILWPVMTLFTAGAVISTFFGRVVRWDVQVRDDRQVPWREAIRLQ
ADALIVGAVLAVGLVFAGDPWLALWMAPLAFALLTSPAQSVLTSRADLGRRARAHGLFLT
ADDTAQAPELAELAQGRLAPVAAPRAG

Enzyme Prediction     

No EC number prediction in MGYG000001265_00623.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	231	425	2.2e-19	0.9593908629441624

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05454	PRK05454	0.0	1	598	4	599	glucans biosynthesis glucosyltransferase MdoH.
COG2943	MdoH	2.14e-150	7	617	28	639	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
cd04191	Glucan_BSP_MdoH	7.43e-135	127	385	1	254	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
cd06423	CESA_like	8.10e-14	130	314	2	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06421	CESA_CelA_like	1.15e-13	156	386	28	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWN44494.1	0.0	14	622	26	630
AWN34920.1	0.0	38	620	65	644
ACB81129.1	8.21e-313	3	619	2	615
QIJ75444.1	1.62e-310	3	619	2	616
AWI89612.1	1.62e-310	3	619	2	616

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6N5U3	8.77e-105	9	590	16	597	Glucans biosynthesis glucosyltransferase H OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) OX=258594 GN=opgH PE=3 SV=1
B3Q6L4	3.40e-104	9	590	16	597	Glucans biosynthesis glucosyltransferase H OS=Rhodopseudomonas palustris (strain TIE-1) OX=395960 GN=opgH PE=3 SV=1
Q9F495	1.26e-102	71	610	199	737	Glucans biosynthesis glucosyltransferase H OS=Dickeya dadantii (strain 3937) OX=198628 GN=opgH PE=3 SV=2
Q1I3R6	1.40e-102	71	610	192	730	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas entomophila (strain L48) OX=384676 GN=opgH PE=3 SV=1
Q8XVC2	1.62e-102	15	610	166	756	Glucans biosynthesis glucosyltransferase H OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999920	0.000094	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
42	64
71	93
400	422
435	457
493	515
536	558
562	584