CAZyme Information: MGYG000001265_01480

Basic Information

• Species: Methylobacterium sp002778835
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Methylobacterium; Methylobacterium sp002778835
• CAZyme ID: MGYG000001265_01480
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	MGYG000001265_78|CGC1	39091.25	6.7552

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001265	4213059	MAG	Italy	Europe

• Gene Location: Start: 2886; End: 4031 Strand: +

Full Sequence      

MSDSDLRRGSTPLGDMAEVMRLTRAGRLDEATALIGRGLSQTGVSSGVPLRPEALRESLG
GLLRDLPDALPSLSTLPGLSGLGRGMTPSVEPIAPASDLQARRFQGPAGARDYRLFVPSA
PRMPAPLVVMLHGCTQTPDDFAAGTGMNALAEAQGVFVAYPAQSARANGQRCWNWFEPAD
QERGAGEPEIIAGITRALIGEFPIDPARVYIAGFSAGGAAAANVARAYPDLYAAVGIHSG
LAAGCARDLPSALAAMRAGAPGEAMPTGLGAAAAVVVPTIVIHGEADAVVSPRNLDAVLA
QAGAERLRASRETLSGGRAGRRTLYTDASGRVLAESVRIEGSGHAWSGGHAAGSYVDPDG
PDASAMMLTFFARHRLGAGRA

Enzyme Prediction     

No EC number prediction in MGYG000001265_01480.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	110	273	9.9e-26	0.5991189427312775

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10503	Esterase_phd	1.56e-51	113	323	3	214	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
COG3509	LpqC	2.29e-38	103	375	39	308	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
TIGR01840	esterase_phb	3.70e-32	113	294	1	186	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
COG4099	COG4099	2.61e-05	98	240	159	302	Predicted peptidase [General function prediction only].
COG0400	YpfH	4.52e-04	116	310	8	175	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY27892.1	2.89e-39	84	371	63	367
AXB79089.1	3.98e-34	63	344	1	282
QDX28074.1	4.98e-34	100	344	31	281
QIJ61082.1	1.35e-32	49	344	4	300
QIK79721.1	1.38e-32	63	344	1	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.91e-09	115	245	21	149	Acetylxylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P52090	5.56e-23	117	358	57	296	Poly(3-hydroxyalkanoate) depolymerase C OS=Paucimonas lemoignei OX=29443 GN=phaZ1 PE=3 SV=1
P12625	7.08e-16	118	379	62	337	Poly(3-hydroxybutyrate) depolymerase OS=Ralstonia pickettii OX=329 PE=3 SV=1
G2QND5	5.82e-11	115	252	38	173	Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Fae1a PE=1 SV=1
A1DBP9	1.71e-10	90	245	26	179	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1
Q4WBW4	4.15e-10	107	245	44	179	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001265_01480.