CAZyme Information: MGYG000001265_01644

Basic Information

• Species: Methylobacterium sp002778835
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Methylobacterium; Methylobacterium sp002778835
• CAZyme ID: MGYG000001265_01644
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1291	MGYG000001265_94|CGC1	143528.99	6.1158

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001265	4213059	MAG	Italy	Europe

• Gene Location: Start: 1550; End: 5425 Strand: +

Full Sequence      

MARLTTYIAGIEKGFKARRKALRQKKIIEESGLFDAKWYAETYWNALEKGEDPALHYLRK
GAAEGKNPSKAFDSRLYLLNNPDVVDTGANPLIHYATHGRREGRTALPVRARKAAEGRPP
VFTVLVRKTSPDETRRTLASLSGQAWTHWHAIPFERFEAAPASAGAPSATDEEGPADGSV
LPALASAGAAIAAARGDFLVFLDGGDILEREALLELSQAREELPYDICYSDETLVGRDDT
ETVQLKPGWSPELLTTYNYFGRLTAIDAGLARRAVEALGAAPRSEWELNLWASRLTPRIE
RLPRILSRRRRGDRTRRDDAALGRSVLETYLAADGIAASAESLPNGLFRAVWPLPAEPKI
SIVIPNKNRFRLISTCIDGLLEKTDYRNIEIIVVDNGSTDADVRAYYESCARSGVRIVAF
DEEFNYSRACNRGAEAATGELLLFLNNDIEVTDPDWLTELVRRALVPGVGVVGPKLLYPD
GEIQHAGVALGLFTLAAHIYHRTPAAEWGVYGPADLLRNWMAVTGACQLIRRDVFELAGG
YDEDFILSYSDIELCARIWKLGFRIVYTPFSVLTHHEGASRGHTNPTDDQILFARRLQAL
GIGQDPYFHPGLDAFNFAPRLRPGSTKAGIATQLRIDIERMAQPFVAKGAPDAHDDGALA
VLAGADWNAFSGRTDIRFTERSAADAARLILTVLGMRRDLRRRFPLALSEGAKGEFADYM
KRDALRTLGLGPDYAPWIDAAFAAGFGDRLRQVAFHDRALREREPLLMLPSGRKALLPRL
YEVVGIDDLPMAELRWLLASIDEQPVRELMITWATNPDWQEAVPAGGTVFGLVELVRWAA
ERHGIGQDWLFRQTTPAIMSDAQQVRVAYRGTQAWQDLFPRALEDEGEARALLEHLARRL
DATSFLARDWLAARDLGALAREVVRPGLNVLGHFSYPSGLRISVESLAAGLAVNGVPTSL
RNVPVSLATDVPLATPAIGCEPYDVTMIHVQPEPLFGEAFRQGGLRPRSPRSYRVGYWYW
EFGEIPESWDRAAMECDELWTATSFVAEGLRERYRQPVRVFLPGLELPAFEAVGRRELGL
EEGVFTLAFVFHMTSVMERKNPVGLIRAFREAFGDSRDARLVIKTSFGERHPDHVEALRE
AAEDANVTIIDEVWTYDRTMSLIQASDAYVSLHRSEGLGLTMAEAMLLGRPVIGSRYSGN
LEFMNDDNSLLVDCTMVKLNRVYPPYAIGQSWAQPSTAHAAEHMRKLFEDRDFARDLGER
GRRSIAETMSYAASGRRMAEHLATITDRLRG

Enzyme Prediction     

No EC number prediction in MGYG000001265_01644.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	361	536	3.7e-26	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	2.11e-45	362	577	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.36e-41	357	600	2	242	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.51e-26	361	535	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd03801	GT4_PimA-like	1.05e-21	976	1282	76	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd00761	Glyco_tranf_GTA_type	1.20e-21	362	567	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK71084.1	6.25e-298	121	1285	147	1321
AGU47945.1	3.18e-295	189	1290	244	1352
QTO19483.1	4.01e-289	109	1291	436	1639
AOI77902.1	4.40e-288	111	1291	444	1639
AQT49385.1	1.23e-287	119	1285	451	1633

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	5.90e-65	190	612	443	888	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.34e-63	108	612	302	831	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P9WMY2	1.96e-13	387	582	31	242	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	1.96e-13	387	582	31	242	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
Q46632	2.58e-12	361	576	7	213	Amylovoran biosynthesis glycosyltransferase AmsB OS=Erwinia amylovora OX=552 GN=amsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001265_01644.