CAZyme Information: MGYG000001265_02648

Basic Information

• Species: Methylobacterium sp002778835
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Methylobacterium; Methylobacterium sp002778835
• CAZyme ID: MGYG000001265_02648
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
207	MGYG000001265_228|CGC1	22145.83	9.3779

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001265	4213059	MAG	Italy	Europe

• Gene Location: Start: 50; End: 673 Strand: +

Full Sequence      

MVLPGSRRSEIERLMPVFGETLARVAATLGPIEVELPAVSRHRAMIERLALAWETPVRLV
HGEDAKFAAFRSARAALAASGTVTLELALAGVPMVVAYKVSRIEEAIARRLIQVPSIVLP
NLILAENAMPEFVQRDCSPETLSASLLPLLAGGLEREQQVASLRRLDDLMRLPCGGEPSR
SAARLVLDVARQRTGGSGAAPLSRGSA

Enzyme Prediction     

No EC number prediction in MGYG000001265_02648.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	2	168	8.1e-47	0.4576271186440678

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.63e-41	2	195	191	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.48e-39	2	192	193	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.56e-26	2	172	190	361	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	2.91e-16	3	140	173	307	lipid-A-disaccharide synthase.
PRK01021	lpxB	0.003	81	140	497	560	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWI91282.1	5.24e-86	2	191	195	384
QIJ77275.1	7.42e-86	2	191	195	384
QIJ82179.1	7.42e-86	2	191	195	384
ACS42731.1	1.49e-85	2	191	195	384
ACB83314.1	2.11e-85	2	191	195	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.08e-21	2	191	196	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.08e-21	2	191	196	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2IW93	1.06e-44	1	192	202	392	Lipid-A-disaccharide synthase OS=Rhodopseudomonas palustris (strain HaA2) OX=316058 GN=lpxB PE=3 SV=1
Q3SRI5	9.29e-43	1	192	201	391	Lipid-A-disaccharide synthase OS=Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255) OX=323098 GN=lpxB PE=3 SV=1
Q6N5R2	1.31e-41	1	191	202	391	Lipid-A-disaccharide synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) OX=258594 GN=lpxB PE=3 SV=1
Q1QMM4	2.74e-41	1	188	201	387	Lipid-A-disaccharide synthase OS=Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14) OX=323097 GN=lpxB PE=3 SV=1
Q89KQ7	4.99e-41	1	192	199	389	Lipid-A-disaccharide synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001265_02648.