CAZyme Information: MGYG000001266_00727

Basic Information

• Species: Atlantibacter hermannii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Atlantibacter; Atlantibacter hermannii
• CAZyme ID: MGYG000001266_00727
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1261	MGYG000001266_3|CGC2	140307.83	6.3975

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001266	4363538	MAG	Italy	Europe

• Gene Location: Start: 54862; End: 58647 Strand: +

Full Sequence      

MVLFRSYWQAGYEGADHVNRLGVPLSMNETTGHLARAAEDYENLNHIAIATVRESVGWRL
ADRHGYYDFTAVAKRMLAAREANVQICWTICHYGWPTELSILDDKFVERFARFSGALAQF
LKPWYAEAPVYSPVNEISFTSWALSVGFIPSSEPPGEPTGHACKRQLVRAALAACDAIWQ
ADSRARILHCDPIIHLAAYEDDAQSQQLALTETLSQYQAWDMLCGREAPELGGAAHYLDL
VGANYYHNNQWHVDSHQPLPWHLGDSRRKPLYEMLTELHERYQRPLLLAETSHVGSGRGA
WINHIATEVAQAQLAGADIRGICLYPILDRPDWEDAQAWHRSGLWEPLHEGADPLLRKID
LPYARALRRAQRSLAHFQGQHRLRQSGKGQTVNTKTLVVFSHLRWDFVWQRPQHLLMRLA
QHYPVVFIEEPVFQEGAAGLHRSAPAPNVTVIRPHSPVHAPGFHDEQIAQLQPLMASLSV
EFPEPVVWFYTPMALPLSEPFHPSLTVYDCMDELSAFKNAPRQLLQRESALLARADLVFT
GGPSLYAAKQHRHQSVWCFPSSVDAAHFEQALDRQNGHPLQADVPHPRLGYYGVIDERID
IDLIAAVADANPDWQIVMVGPVVKIDPASLPQRGNIHYFGQQPYQALPQFLAGWDVCLMP
FALNASTRFISPTKVLEYMAASLPIVSTEIADVKKPYGDIVFVAEDRDAFVRGCARALAL
SEQESQQQAGQMKAIINATSWDATVDAMHKLMADALQDLAAGAEAAREAPGAGAAPVVTR
IPSTAKPDAHFARCLILGAGPTGLSAALHIGEEAVLLEKNPTVGGWCRSVEDKGFTFDYA
GHIMFSADPYVLEMYALLLKDNLHWQNREAWIYSQNTYTRYPFQSALYGLPAPIIKECIL
GAVEAQYNAASRLQPANAPALKMEDCCGDGAVPQDDCLLTARDKRAANFEQFIYQTWGAG
IAKYFAVPYNRKLWKVPLAEMETSWLGGRVPLPDLGQIIDGALAPSSRPVGPNARFGYPL
RGGFQALMSGFLPLLKGKLETNARIIKLLPREHIAVLADGRRYRYEQLISTMPLPVLVTM
LEGDVPEAVRTAAKGLRHTSVRCVNLGIGRSDLTEKHWIYYPEDTVFHRIFVQGNASPYC
NPPGGCGLTCEITYSPDVPLPVDGQALIDRCVAECIRVGIINADDEILTANTVDIPYAYV
IYDHARAANVDTVRQWLLSHDILLAGRYSEWEYYNSDHAFLAGKKAAENVASRLKRVEAG
M

Enzyme Prediction     

No EC number prediction in MGYG000001266_00727.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04950	GT4_TuaH-like	1.92e-119	395	752	5	370	teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK07208	PRK07208	9.60e-52	795	1251	8	458	hypothetical protein; Provisional
COG1232	HemY	1.47e-47	795	1252	4	444	Protoporphyrinogen oxidase [Coenzyme transport and metabolism].
cd03794	GT4_WbuB-like	1.43e-15	410	727	18	368	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03801	GT4_PimA-like	6.33e-14	512	751	118	364	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPS90288.1	0.0	1	1261	1	1261
QHM70062.1	0.0	1	1253	1	1253
QHM76440.1	0.0	1	1253	1	1251
QNU44440.1	0.0	1	1253	1	1254
AIX74618.1	0.0	1	1253	1	1254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UTE_A	3.21e-43	795	1252	14	477	Crystalstructure of Aspergillus fumigatus UDP galactopyranose mutase sulfate complex [Aspergillus fumigatus],3UTE_B Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase sulfate complex [Aspergillus fumigatus],3UTE_C Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase sulfate complex [Aspergillus fumigatus],3UTE_D Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase sulfate complex [Aspergillus fumigatus],3UTF_A Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase in reduced state [Aspergillus fumigatus],3UTF_B Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase in reduced state [Aspergillus fumigatus],3UTF_C Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase in reduced state [Aspergillus fumigatus],3UTF_D Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase in reduced state [Aspergillus fumigatus],3UTG_A Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with UDP in reduced state [Aspergillus fumigatus],3UTG_B Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with UDP in reduced state [Aspergillus fumigatus],3UTG_C Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with UDP in reduced state [Aspergillus fumigatus],3UTG_D Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with UDP in reduced state [Aspergillus fumigatus],3UTH_A Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with substrate UDP-Galp in reduced state [Aspergillus fumigatus],3UTH_B Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with substrate UDP-Galp in reduced state [Aspergillus fumigatus],3UTH_C Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with substrate UDP-Galp in reduced state [Aspergillus fumigatus],3UTH_D Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with substrate UDP-Galp in reduced state [Aspergillus fumigatus],4GDE_A Crystal structure of NADPH-reduced Aspergillus fumigatus UDP-galactopyranose [Aspergillus fumigatus],4GDE_B Crystal structure of NADPH-reduced Aspergillus fumigatus UDP-galactopyranose [Aspergillus fumigatus],4GDE_C Crystal structure of NADPH-reduced Aspergillus fumigatus UDP-galactopyranose [Aspergillus fumigatus],4GDE_D Crystal structure of NADPH-reduced Aspergillus fumigatus UDP-galactopyranose [Aspergillus fumigatus],5VWT_A Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADPH [Aspergillus fumigatus],5VWT_B Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADPH [Aspergillus fumigatus],5VWT_C Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADPH [Aspergillus fumigatus],5VWT_D Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADPH [Aspergillus fumigatus],5VWU_A Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADH [Aspergillus fumigatus],5VWU_B Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADH [Aspergillus fumigatus],5VWU_C Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADH [Aspergillus fumigatus],5VWU_D Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADH [Aspergillus fumigatus]
4U8K_A	1.92e-42	795	1252	14	477	Structureof Aspergillus fumigatus UDP-Galactopyranose mutase mutant Q107A [Aspergillus fumigatus],4U8K_B Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant Q107A [Aspergillus fumigatus],4U8K_C Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant Q107A [Aspergillus fumigatus],4U8K_D Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant Q107A [Aspergillus fumigatus]
3UKL_A	2.46e-42	795	1252	10	473	Crystalstructure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus],3UKL_B Crystal structure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus],3UKL_C Crystal structure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus],3UKL_D Crystal structure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus],3UKL_E Crystal structure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus],3UKL_F Crystal structure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus],3UKL_G Crystal structure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus],3UKL_H Crystal structure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus]
3UKH_A	2.87e-42	795	1252	10	473	Crystalstructure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus],3UKH_B Crystal structure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus],3UKH_C Crystal structure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus],3UKH_D Crystal structure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus],3UKH_E Crystal structure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus],3UKH_F Crystal structure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus],3UKH_G Crystal structure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus],3UKH_H Crystal structure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus]
4U8I_A	3.48e-42	795	1252	14	477	Structureof Aspergillus fumigatus UDP-Galactopyranose mutase mutant F66A [Aspergillus fumigatus],4U8I_B Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant F66A [Aspergillus fumigatus],4U8I_C Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant F66A [Aspergillus fumigatus],4U8I_D Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant F66A [Aspergillus fumigatus],4U8N_A Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant F66A complexed with UDP [Aspergillus fumigatus],4U8N_B Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant F66A complexed with UDP [Aspergillus fumigatus],4U8N_C Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant F66A complexed with UDP [Aspergillus fumigatus],4U8N_D Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant F66A complexed with UDP [Aspergillus fumigatus],4WX1_A Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant F66A determined from a crystal soaked with UDP-Galactopyranose [Aspergillus fumigatus],4WX1_B Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant F66A determined from a crystal soaked with UDP-Galactopyranose [Aspergillus fumigatus],4WX1_C Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant F66A determined from a crystal soaked with UDP-Galactopyranose [Aspergillus fumigatus],4WX1_D Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant F66A determined from a crystal soaked with UDP-Galactopyranose [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32267	2.29e-09	463	728	86	369	Putative teichuronic acid biosynthesis glycosyltransferase TuaH OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaH PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001266_00727.