CAZyme Information: MGYG000001266_01762

Basic Information

• Species: Atlantibacter hermannii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Atlantibacter; Atlantibacter hermannii
• CAZyme ID: MGYG000001266_01762
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221	MGYG000001266_8|CGC2	24396.85	9.021

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001266	4363538	MAG	Italy	Europe

• Gene Location: Start: 101944; End: 102609 Strand: +

Full Sequence      

MNVIKLLNVENMTMDITQFQCAAGISLTLAKRWYIPVTTAMQEFGIVKSDDQAMFIAQAG
HESGGFSRLTESFNYSVSGLAGFIRAGRLTQAQANALGRRQGELAVPQERQRAIANLVYS
KRMGNHAPADGWSYRGRGLIQITGLANYRDCGDGLKVDLVSHPELLADDEYAARSAAWFF
ATKGCLHYTGDLVRITRLINGGQNGIDDRKARYMMAREVLL

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	47	182	7.6e-35	0.43722943722943725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	1.31e-64	12	221	2	205	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	3.19e-13	34	202	26	189	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	2.67e-08	129	182	102	156	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDZ72237.1	2.93e-158	1	221	1	221
QPS90786.1	2.58e-149	14	221	1	208
ASG82629.1	1.18e-113	14	221	1	208
ASG82647.1	1.18e-113	14	221	1	208
ATM92570.1	1.73e-113	14	220	1	207

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	4.00e-112	14	220	16	222	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
4TX7_A	1.64e-07	129	182	108	162	Crystalstructure of chitinase (GH19) from Vigna unguiculata [Vigna unguiculata subsp. sesquipedalis]
3CQL_A	7.44e-07	129	182	106	160	CrystalStructure of GH family 19 chitinase from Carica papaya [Carica papaya],3CQL_B Crystal Structure of GH family 19 chitinase from Carica papaya [Carica papaya]
4IJ4_A	1.91e-06	129	202	88	166	CrystalStructure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
3WH1_A	1.93e-06	129	202	89	167	CrystalStructure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	5.48e-26	34	213	22	191	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O64203	5.28e-09	123	219	250	360	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1
Q41596	4.06e-06	125	182	172	230	Endochitinase 1 OS=Theobroma cacao OX=3641 GN=CHIA1 PE=2 SV=1
Q10S66	5.92e-06	122	182	110	170	Chitinase 11 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht11 PE=2 SV=1
P85084	7.47e-06	129	182	106	160	Endochitinase OS=Carica papaya OX=3649 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001266_01762.