CAZyme Information: MGYG000001266_02256

Basic Information

• Species: Atlantibacter hermannii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Atlantibacter; Atlantibacter hermannii
• CAZyme ID: MGYG000001266_02256
• CAZy Family: GH73
• CAZyme Description: Peptidoglycan hydrolase FlgJ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		34814.33	6.889

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001266	4363538	MAG	Italy	Europe

• Gene Location: Start: 36205; End: 37170 Strand: -

Full Sequence      

MLNDTKLLSSAAWDANSLNDLKAKAGHDPKANIKAVAQQVEGMFVQMMLKSMREALPKDG
MFSSDQTRLYTSMYDQQIAQHMSAGKGLGLAEAMVKQMSSESQEPSETTDKVPLKFDLET
INRYQVQTLAQTVRQAVPRPASEPPQTSQDGPLTGDSKDFLAALSLPAKLASEQSGVPHH
LILAQAALESGWGQRQILKANGEPSFNLFGIKASPGWKGEVAEVTTTEYENGEAIKVKAK
FRAYGSYLEALSDYVSFLTRNPRYAAVTSAATAEQGATALQNAGYATDPNYARKLTSMIG
QLKAMSEKVSKAYSNDISTLF

Enzyme Prediction     

No EC number prediction in MGYG000001266_02256.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	169	302	6.3e-34	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05684	flgJ	0.0	2	317	1	312	flagellar assembly peptidoglycan hydrolase FlgJ.
TIGR02541	flagell_FlgJ	3.53e-135	11	303	1	294	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK12712	flgJ	6.25e-86	12	304	17	344	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12709	flgJ	1.74e-80	3	302	6	319	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12713	flgJ	6.81e-77	11	304	15	328	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPS93240.1	7.09e-225	1	321	1	321
VDZ74017.1	7.09e-225	1	321	1	321
QFH71925.1	1.18e-201	1	321	1	315
BBS92272.1	1.66e-169	1	321	1	316
BBR21378.1	1.66e-169	1	321	1	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN4_A	3.88e-93	156	321	2	167	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	1.55e-86	156	306	2	152	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.51e-35	160	299	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.96e-35	160	299	5	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.50e-34	160	299	5	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15931	2.72e-169	1	321	1	316	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
P75942	9.45e-160	1	321	1	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	3.14e-158	1	321	1	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
Q9I4P4	1.91e-45	9	303	15	386	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
Q9X9J3	4.82e-40	14	305	13	308	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001266_02256.