CAZyme Information: MGYG000001266_02425

Basic Information

• Species: Atlantibacter hermannii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Atlantibacter; Atlantibacter hermannii
• CAZyme ID: MGYG000001266_02425
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1033	MGYG000001266_15|CGC3	115377.37	5.3576

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001266	4363538	MAG	Italy	Europe

• Gene Location: Start: 32216; End: 35317 Strand: +

Full Sequence      

MNYCNQYPELEKFKGLRVAVLTTESAQGEAGGAERFYQGLLAGLIEIGCDAEIVQVIADE
SSFDQISKNYQYCRDLDLSRFDAVVSTKTPSYAVNHPNHVMYLVHTVRVFDDMFYETFPG
DDPIRLAERAMLHQWDFEAISRVKAKFAIGHEVSNRLYRWRGIHCDVIHPPLGVNGFKQG
TTGDYFFLPGRLHPWKRVHLAIEAVKASSLPLRLVIAGTGEAEQELKALAAGDSRIEFVG
RLSDEELLDYYANALAIAFVPKKEDYGYVTLEGFASGKPVITCADSGEPTFFVKHKETGL
ICEANPEALCEGFEWLFNNVSSAIAMGQRGHELIKGMSWATVSKQLISAAMAPQVTLKEM
PLSVVVADMQPIDPPIGGGRLRLLGLYHGLGENVKATYVGSYDWPGEKYRRHQLSPGLEE
INIPLSQEHHLAAQEWAAQANGKTVIDVVFSQQGHLSPDYLTSVIENIKQAEVVVFSHPW
VYPLIDPNLLQGKVVVYDSQNVEGYLRAQLFDDSNVAELAAIRQVIADEYLLGQRADLIL
ACSQEDLLRFYRIYEFSPEKMRVVPNGVMAFTHQVPGDDERSAAKVALKYAADDKLAIFI
GSAYGPNVEAAKFIAETLAPLVPEVTFVIAGGVGSVVEKVKYKNVHVTGMLSEEDKALWL
SAADIAVNPMFSGSGTNIKMFDFMSMAMPTVTTKIGARGIDTGGLTAMLVVEPTKEAFAT
AISDLFENEYRRKVGTAARACVESSYAWERISDIVGRMLSSRAQLANQPQPHFSVVIPSY
ERPDQLLDLVSCLQKQTERDFEVIIVDQSEKPWSERGRDFGFPLCYYHSPVKGAVRARNT
GAMLAQGKVIAFTDDDCRPGANWLANARKYFEVEGVVGVEGIIISDHHGDDNWRPVTNVG
FESIGFMTANLMVRNSVFQYLGGFDLQFDHPHFREDTDFGWRMQQLGLVPYAKDVDVFHP
AQLRSKERESASSRARFFQKDVLLYRKHPEKYQELFLQERHYVITSGFKENLLLGFKIEN
EPVPQWMAELLNA

Enzyme Prediction     

No EC number prediction in MGYG000001266_02425.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	183	326	4.1e-24	0.93125
GT2	774	932	1.5e-18	0.9176470588235294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03804	GT4_WbaZ-like	1.13e-36	31	311	13	322	mannosyltransferase WbaZ and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbaZ in Salmonella enterica has been shown to possess mannosyltransferase activity.
cd03801	GT4_PimA-like	1.23e-29	17	348	1	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03801	GT4_PimA-like	5.77e-27	510	759	115	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	8.30e-24	17	348	1	372	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	5.83e-22	183	330	1	155	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPS93086.1	0.0	1	1033	1	1033
QDL33009.1	0.0	1	1033	1	1033
QLH62985.1	0.0	1	1033	1	1033
VDZ74211.1	0.0	1	773	1	773
AYO79263.1	0.0	12	1033	14	1038

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F9F_A	1.68e-12	162	319	2	162	CrystalStructure of the Putative Mannosyl Transferase (wbaZ-1)from Archaeoglobus fulgidus, Northeast Structural Genomics Target GR29A. [Archaeoglobus fulgidus DSM 4304]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9HTC0	9.65e-11	177	328	187	341	D-rhamnosyltransferase WbpZ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=wbpZ PE=1 SV=1
P46370	1.02e-08	689	947	64	316	Uncharacterized 55.3 kDa protein in thcA 5'region OS=Rhodococcus erythropolis OX=1833 PE=4 SV=1
D4GYG7	1.31e-07	771	962	6	211	Glycosyltransferase AglE OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglE PE=1 SV=1
D4GYH2	2.92e-07	765	962	1	210	Glycosyltransferase AglI OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglI PE=1 SV=1
Q48214	5.16e-07	774	856	3	86	Uncharacterized glycosyltransferase HI_1696 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1696 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001266_02425.