CAZyme Information: MGYG000001266_02933

Basic Information

• Species: Atlantibacter hermannii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Atlantibacter; Atlantibacter hermannii
• CAZyme ID: MGYG000001266_02933
• CAZy Family: GT2
• CAZyme Description: Acetyl-coenzyme A synthetase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652	MGYG000001266_22|CGC1	72112.61	6.0656

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001266	4363538	MAG	Italy	Europe

• Gene Location: Start: 13185; End: 15143 Strand: -

Full Sequence      

MSQIHKHAIPANIAEHCLINPEQYEAKYQQSIHDPDAFWGEQGKILDWIKPYQQVKNTSF
EPGNISIKWFEDGTLNLAANCLDRHLAENGDRTAIIWEGDDASQSKHITYRDLHRDVCRF
ANTLVDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSA
RLVITADEGVRAGRTIPLKKNVDDALKNPGVKTIENVIVLKRTGANTEWHEGRDKWWHEL
TEKASAHHQPVEVNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYQPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPNRMAQVIDKHKVTILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGQPLSGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPTAQLYTEVRNWVRKEIGPLATPDILHWTD
SLPKTRSGKIMRRILRKIAAGDTSNFGDTSTLADPGVVEKLLEEKQAITMPS

Enzyme Prediction     

No EC number prediction in MGYG000001266_02933.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05967	PrpE	0.0	24	638	1	614	Propionyl-CoA synthetase (PrpE). EC 6.2.1.17: propanoate:CoA ligase (AMP-forming) or propionate#CoA ligase (PrpE) catalyzes the first step of the 2-methylcitric acid cycle for propionate catabolism. It activates propionate to propionyl-CoA in a two-step reaction, which proceeds through a propionyl-AMP intermediate and requires ATP and Mg2+. In Salmonella enterica, the PrpE protein is required for growth of Salmonella enterica on propionate and can substitute for the acetyl-CoA synthetase (Acs) enzyme during growth on acetate. PrpE can also activate acetate, 3HP, and butyrate to their corresponding CoA-thioesters, although with less efficiency.
TIGR02188	Ac_CoA_lig_AcsA	0.0	18	644	1	626	acetate--CoA ligase. This model describes acetate-CoA ligase (EC 6.2.1.1), also called acetyl-CoA synthetase and acetyl-activating enzyme. It catalyzes the reaction ATP + acetate + CoA = AMP + diphosphate + acetyl-CoA and belongs to the family of AMP-binding enzymes described by pfam00501.
COG0365	Acs	0.0	68	631	1	528	Acyl-coenzyme A synthetase/AMP-(fatty) acid ligase [Lipid transport and metabolism].
cd05968	AACS_like	0.0	22	635	7	610	Uncharacterized acyl-CoA synthetase subfamily similar to Acetoacetyl-CoA synthetase. This uncharacterized acyl-CoA synthetase family (EC 6.2.1.16, or acetoacetate#CoA ligase or acetoacetate:CoA ligase (AMP-forming)) is highly homologous to acetoacetyl-CoA synthetase. However, the proteins in this family exist in only bacteria and archaea. AACS is a cytosolic ligase that specifically activates acetoacetate to its coenzyme A ester by a two-step reaction. Acetoacetate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. This is the first step of the mevalonate pathway of isoprenoid biosynthesis via isopentenyl diphosphate. Isoprenoids are a large class of compounds found in all living organisms.
PRK00174	PRK00174	0.0	6	648	1	636	acetyl-CoA synthetase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE6201330.1	9.39e-245	20	642	578	1210
CAE6201338.1	1.29e-244	20	642	589	1221
BAY30132.1	1.63e-25	60	615	566	1079
AFZ04852.1	1.70e-25	61	615	565	1074
BAY90071.1	2.16e-25	60	622	565	1089

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P2Q_A	0.0	1	652	1	652	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2Q_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P2J_A	0.0	1	652	1	652	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2J_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P2M_A	0.0	1	652	1	652	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2M_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P2F_A	0.0	1	652	1	652	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2F_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
5JRH_A	0.0	1	652	1	652	Crystalstructure of Salmonella enterica acetyl-CoA synthetase (Acs) in complex with cAMP and Coenzyme A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5JRH_B Crystal structure of Salmonella enterica acetyl-CoA synthetase (Acs) in complex with cAMP and Coenzyme A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7MBA6	0.0	1	650	1	650	Acetyl-coenzyme A synthetase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=acs PE=3 SV=1
Q8D1G8	0.0	1	652	1	652	Acetyl-coenzyme A synthetase OS=Yersinia pestis OX=632 GN=acs PE=3 SV=2
Q87KU7	0.0	1	645	1	646	Acetyl-coenzyme A synthetase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=acsA PE=3 SV=1
Q7MGU3	0.0	1	645	1	646	Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=acsA PE=3 SV=2
Q8DCZ9	0.0	1	645	1	646	Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=acsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999685	0.000326	0.000024	0.000001	0.000000	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001266_02933.