CAZyme Information: MGYG000001266_03043

Basic Information

• Species: Atlantibacter hermannii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Atlantibacter; Atlantibacter hermannii
• CAZyme ID: MGYG000001266_03043
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
900		100097.59	5.3381

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001266	4363538	MAG	Italy	Europe

• Gene Location: Start: 6033; End: 8735 Strand: -

Full Sequence      

MPVVPTVQGRQVESRGVQTGGFQTFQQPNIGDALIKAGSQAINVFSEAKQRANVALSQEA
GLKLSQAEQSMKTELFSLKGQNAFGKGLEFTQKYDQQIQELSSSLPDDAARQMFMQQAAQ
QRMQFVGNVNRYERGQVDEFEANQYDATRQQQLQSEADSWNDPQAAALAKNSRMVATSRF
GVARGWSQEQILAEIEKDNRAAAELRGKNYAVANPLGWLNGEFSGADGGSLDMRAVGIVE
SGGRHLTADGKVLEGPVTRSGDRAQGMFQIMPETGKELAARRGVSYDPADEQQHSMLAAD
YAQQLSGKYGSELLAGAAYNWGPGNVDKLLQSGDPRKGEISEAEFVAKLPAETRGWISRY
RKNKTGMDPVTVYQIDNLANAQIEKQRKTVLESLEPLLNNTMAQLYNGEVPEAMPSMAAI
MFGYGDQGKKMVAQLDIAMDNAKKFQAIQYLPPAEQQQELLSFKPQVNDPQYALKLDAYG
KLTSLVSRSNETIQAQRDSRKFNEAAATGEKLDPSDKAMQKAAEYTAAAQNFRINDGTTH
DGVVQLVAQTGIVPSQVTSQLSAVSRSQNPQVVIQGAGIFNRIYDTDPAAVGDLPKEIQG
FYLTVKQLSDAGMSSEAAVTQAQNVTYNQTDAVKQQLSSTQSTKEYKKERVRAMDSVVSD
MSGWFRIDPSADDANPESARFRNDYQALYDINYRTAGGNADAAKKMTNQQIARTWSISEV
NGIAKLMKYAPEALHSYGPSGWQSEQWKADKEQLMYGDRKEQIVTSPTQLGITSGRAEPL
TTKTPESRIGGELEVTPDVLTPRNGDYAIMVRTKDKDGIEAVQPFYDSYGRPMRWKPSLE
EWEPYKKSMQEREQKEREEILRGQEIRGFKDKHRAIDEQYRRFHDDRVNRFKNYFSWSDE

Enzyme Prediction     

No EC number prediction in MGYG000001266_03043.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PHA00658	PHA00658	1.19e-15	38	359	63	423	putative lysin
cd16894	MltD-like	4.58e-14	228	360	5	124	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd00254	LT-like	1.20e-13	234	363	5	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.25e-12	259	355	39	137	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	3.58e-09	264	364	42	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD5353680.1	0.0	1	900	1	896
ATX96370.1	0.0	1	900	1	896
QPO77436.1	0.0	1	900	1	897
QPO72586.1	0.0	1	900	1	897
QPO83329.1	0.0	1	900	1	897

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001266_03043.