CAZyme Information: MGYG000001268_01485

Basic Information

• Species: Rothia mucilaginosa_B
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia mucilaginosa_B
• CAZyme ID: MGYG000001268_01485
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42010.69	6.0549

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001268	1847122	MAG	Italy	Europe

• Gene Location: Start: 7; End: 1155 Strand: +

Full Sequence      

MHRILGVPGALIGSVQVPDPRPLSQRLNVWHYWWQAHLLDCVIDAGQRHLREGDITAAQE
ELHRARALLRGINVRNYGRFANDYFDDMAWLTLAVGRMNSFCIELTGANDVAAQDAGAAL
FEQLAKGISPVGGMSWRKSKRDFVNAAATAPTALAYVRAGDPKTAAALMDWMNETLWDAE
RSLYIDGVNVRGDEYEYERGEFTYNQGTALGALLSLAASGVPCEVDPAERAERLIVGIVK
HMTEEVEFLSGARRRILISHGNGDGGLFTGILVRYLGMAASSPLLSDEARALASTLVYST
ARALWEGRREFDPNLPMNEYGIDPNEIRGKALVQFSPRFTEPMSKVVKPGAPVELSTQVQ
AWTIFETAARLAHARDLAAHGF

Enzyme Prediction     

No EC number prediction in MGYG000001268_01485.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	28	313	1.5e-56	0.7569832402234636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	7.56e-41	3	369	17	368	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAS19786.1	1.96e-278	1	382	39	420
BAI65589.1	5.73e-276	1	382	116	497
QXW99112.1	7.62e-276	1	382	39	420
ATF62942.1	2.55e-274	1	382	39	420
BAV86349.1	5.41e-150	2	371	38	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	7.94e-27	30	371	86	389	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.89e-25	30	371	87	390	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	1.24e-24	30	371	87	390	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	5.60e-15	28	309	41	303	ChainA, Lin0763 protein [Listeria innocua]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.886780	0.110457	0.001906	0.000291	0.000161	0.000409

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001268_01485.