CAZyme Information: MGYG000001269_00469

Basic Information

• Species: Rothia mucilaginosa
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia mucilaginosa
• CAZyme ID: MGYG000001269_00469
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000001269_10|CGC1	35066.73	6.9798

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001269	2178797	MAG	Italy	Europe

• Gene Location: Start: 737; End: 1690 Strand: +

Full Sequence      

MTTTHRYKAAVIIPSRGGANILHYPLDALAAQTEKDFQVIVVLDGDIDNSEAVLDRYIAE
GKLNLTKIVFEENRGRVAALNAGHRAADADILIRCDDDLEPDPNYVANHLKYHEAPGEHG
VIGIYLNQFPDTPYSRVYGNYRDQKFREAAYQVAPEKRWIYWAGNVSMSKKLFDEIGGYD
PAYRLYGWEDVDMGYEVAQHGGEIHIAPELATKHYVAATTTAVRALRALHSGSARTIFVR
KHGDAAHPAPNPTGAWGLLVKALARFTTEKTIKALGDASDKILLKLPAKAAEKLVALQVE
AASYAGIHYPERAQKVF

Enzyme Prediction     

No EC number prediction in MGYG000001269_00469.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	11	176	3.4e-25	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	1.34e-26	11	206	1	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	1.30e-25	11	173	2	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	1.51e-19	6	242	2	247	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	2.16e-19	11	216	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02525	Succinoglycan_BP_ExoA	4.63e-18	11	216	4	209	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAI65410.1	2.33e-184	1	317	1	315
BAS19628.1	1.35e-183	1	317	1	315
ATF62793.1	2.59e-181	1	317	1	315
QXW98968.1	5.22e-181	1	317	1	315
BAV87416.1	9.13e-159	5	317	16	326

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
H2K893	1.15e-15	3	209	5	236	Validoxylamine A glucosyltransferase OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008) OX=1133850 GN=valG PE=1 SV=1
Q15JF5	7.65e-15	3	209	36	267	Validoxylamine A glucosyltransferase OS=Streptomyces hygroscopicus subsp. limoneus OX=264445 GN=vldK PE=3 SV=1
P22639	1.35e-06	8	98	2	91	Uncharacterized glycosyltransferase alr2836 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=alr2836 PE=3 SV=2
P70419	1.59e-06	38	208	219	409	Polypeptide N-acetylgalactosaminyltransferase 3 OS=Mus musculus OX=10090 GN=Galnt3 PE=1 SV=3
Q6WV16	2.86e-06	20	208	216	420	N-acetylgalactosaminyltransferase 6 OS=Drosophila melanogaster OX=7227 GN=Pgant6 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001269_00469.