CAZyme Information: MGYG000001269_00860

Basic Information

• Species: Rothia mucilaginosa
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia mucilaginosa
• CAZyme ID: MGYG000001269_00860
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	MGYG000001269_28|CGC1	34169.2	4.2429

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001269	2178797	MAG	Italy	Europe

• Gene Location: Start: 3182; End: 4177 Strand: +

Full Sequence      

MDHLSTPGSAPAAFASRPDAFASHSAAAPRTVSTEAAAASDSAPEPGTRANYQDALLFVA
PPLLSVAVLGALSVNLHRIPSAHPLADASLLCAGAAAVLITAWWFISFIYALFYAWSLRV
SSHNADRAVLKVPAFFRPRFMRRIVLTLGGTALGVGAVLAPAQATVVTPSNAGVSGTEGM
PQTTISAVITTDSMGTADSMGTATADANPGSNADAALSDTAPDQSATPLALSAEIPDIPL
APQPSEAAGSLQDRSPFFSPPRTEAGTYSYTVQAGDTLWSIAADQLGEGTDASTIYDYTL
DIYEANKDALGQNAELLYEGQVLQIPEQPVH

Enzyme Prediction     

No EC number prediction in MGYG000001269_00860.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	2.21e-09	270	327	98	147	LysM domain/BON superfamily protein; Provisional
cd00118	LysM	1.55e-08	269	325	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	1.46e-06	270	325	2	44	Lysin motif.
pfam01476	LysM	1.51e-06	270	326	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
COG1652	XkdP	2.40e-06	220	328	162	264	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXW98223.1	1.15e-175	1	331	1	320
ATF63722.1	1.29e-166	1	331	1	305
BAS20589.1	1.96e-166	1	331	1	346
VEI23440.1	1.11e-19	48	326	6	258
VEJ29802.1	2.62e-16	54	328	11	341

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999879	0.000127	0.000000	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
55	77
92	114
144	166