CAZyme Information: MGYG000001270_00418

Basic Information

• Species: Corynebacterium sp902373425
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium sp902373425
• CAZyme ID: MGYG000001270_00418
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	MGYG000001270_16|CGC1	54150.56	4.5822

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001270	2256923	MAG	Italy	Europe

• Gene Location: Start: 1997; End: 3436 Strand: +

Full Sequence      

MSLSHENQSAFPKGFLWGGATAANQIEGAYNEGGKGLSIQDVLPQGLMAPPTEEPTDDNL
KLHAIDFYHRYADDIALLAEMGFKVFRFSIAWSRIFPNGDDNAPNEEGLAFYDKVLDELE
KHGIEPLITLSHYETPLNLARSYGGWKNRQLIDFYEKYARTIFNRYKGRVKYWLTFNEVN
SILHQPFIGGAIEASREDVSDTDIYQAVHNILVASARATKVGHEIDPNNQIGCMVLSIPR
YPLTPKPADALRAQYETQLDACFGDIHVFGEYPHTLKRLFRENNITLTTTDDDFDVMKNN
TVDFVSFSYYMSVAESADPEAERGEGNIMGGVVNPELDVSEWGWAIDPEGLRYALNSMWD
RWHKPLFIVENGLGAVDKLVDDASAPEGKAVHDQYRIDYMNDHLVQVEEAIKDDIPVMGY
TSWGCIDLISASTAEIRKRYGFIYVDLNSDGSGSLQRYRKDSFDWYKNVIATNGESLKR

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	8	474	9.4e-148	0.993006993006993

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	9	477	2	473	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	9	476	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	10	477	5	477	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	0.0	9	477	2	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	4.60e-163	11	477	6	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ65794.1	0.0	1	479	1	479
QRP10170.1	0.0	1	479	1	479
ACR18502.1	0.0	1	479	1	479
QRP14119.1	0.0	1	479	1	479
AHI21659.1	5.97e-280	8	479	4	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IPL_A	7.25e-212	7	477	16	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
6WGD_A	1.50e-204	6	477	3	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
3QOM_A	4.32e-165	10	478	10	481	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
4F66_A	7.11e-156	9	477	5	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.02e-155	9	477	5	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46130	2.81e-229	10	479	6	473	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	2.03e-204	7	477	4	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	9.16e-185	11	478	4	463	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P11988	1.14e-179	10	479	3	464	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
P26206	3.88e-179	11	479	5	465	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001270_00418.