CAZyme Information: MGYG000001270_01603

Basic Information

• Species: Corynebacterium sp902373425
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium sp902373425
• CAZyme ID: MGYG000001270_01603
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785		84479.32	4.3978

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001270	2256923	MAG	Italy	Europe

• Gene Location: Start: 1093; End: 3450 Strand: -

Full Sequence      

MSTLRTTSYPAGSILARVRTTIDGPLIEAHTSAGELSIRIEDDHPHITTRTPERVQDLDV
EDATTITDGQWHSIALTVGPEGTKFYLDGYQAFCGTATAVLADVQVEELTIADAPVDVAD
VVCTGSVLSDNDVLAHAMPPQPMVQFAANHLADYDTRRVARLGAGTTLTRFRVRGVGQGG
TILSAGYVEADGEDVERLRLSVSDTELTYEVLTSEDEWRTFAVDGHWADGTWHDVVIRAG
EGAVDLYVDGFREARIPGQAFFADASTVNTITIGQDIHGRRLFGEVARAAIYPTPLTDGA
IKRLSHVDPVHTQALFDRGMYGAVSYRIPSLLTLPSGTVIAGADQRTTIANDAPNDINFV
IRRSLDGGDHWEDMQTILAYPGSGATGASVIDSCTVYDEDTGTVHLLIDHFPGGIGQPNN
VHGVGQDSQGRLILTDASAEVAGSDEASDAAEDTDAAPSPATYMLNADGSVITEEGKATE
FSVDKEGWITRAGQPAGNIYLADGEDPNQTLLTLRTSYIVHVTSDDEGETWSAPELINHQ
VKEEWMAFLGTSPGTGVQLHHGARAGRLVIPVYYSGDNPKHFSCAVIYSDDHGKTWHRGA
SPNDGRLFKGATIDSRTLADDEASTHESTLVELEDGRLMVLMRNQHPSGRVGTAISEDGG
ETWGEVTYHPDISEIFSQPNAIAIDGPAGVAGSGGAPLYVFANASQLMPYRGNGMLRVST
DEGETWPIARTFNPGHYVYQSMTHLPNGKIGLLWENEWQGLYLTQIPLSWFGPELQKRGG
STHGD

Enzyme Prediction     

No EC number prediction in MGYG000001270_01603.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	313	757	2.1e-97	0.935672514619883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	9.34e-88	313	762	1	330	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	2.58e-23	516	752	79	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	1.31e-15	326	755	275	700	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam13859	BNR_3	2.05e-07	519	665	90	213	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam02210	Laminin_G_2	0.002	180	274	8	97	Laminin G domain. This family includes the Thrombospondin N-terminal-like domain, a Laminin G subfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ65718.1	0.0	1	785	1	785
ACR18588.1	0.0	1	785	1	795
QRP10095.1	0.0	1	785	1	795
QRP14191.1	0.0	1	785	1	795
QGS10500.1	2.68e-265	9	770	7	739

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TSP_A	7.09e-74	296	755	1	430	Crystalstructure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124],5TSP_B Crystal structure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124]
2BF6_A	3.76e-72	298	755	2	429	AtomicResolution Structure of the bacterial sialidase NanI from Clostridium perfringens in complex with alpha-Sialic Acid (Neu5Ac). [Clostridium perfringens]
2VK5_A	4.08e-72	298	755	2	429	TheStructure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK6_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_B The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens]
2W20_A	7.98e-62	322	760	22	453	Structureof the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6],2W20_B Structure of the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6]
3H72_A	9.21e-62	322	760	26	457	Crystalstructure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H72_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H73_A Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6],3H73_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29767	7.04e-65	99	755	176	809	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P62575	1.03e-57	322	760	342	773	Sialidase A OS=Streptococcus pneumoniae OX=1313 GN=nanA PE=1 SV=1
P62576	1.03e-57	322	760	342	773	Sialidase A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=nanA PE=1 SV=1
Q02834	4.95e-33	308	772	48	402	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
Q27701	5.66e-29	246	755	206	729	Anhydrosialidase OS=Macrobdella decora OX=6405 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001270_01603.