CAZyme Information: MGYG000001271_00177

Basic Information

• Species: UBA644 sp002299265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; UBA644; UBA644; UBA644 sp002299265
• CAZyme ID: MGYG000001271_00177
• CAZy Family: CE4
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292	MGYG000001271_1|CGC2	33263.31	7.0821

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001271	1995172	MAG	Italy	Europe

• Gene Location: Start: 181842; End: 182720 Strand: -

Full Sequence      

MSEWLRKKMFRRTVCVLTAICLTCMIALKNPIFFAKENESATVVILMYHSLLKDPARHGK
YVVSPDLFESDLKYLKELGYSFVGIQELIDFVYSGAPLPKKSVVITFDDGYYNNYLYAYP
LLEKYDAKMVISVIGKYTDLYDGEKPNAYYSHVTWDMINEMLASGRVEIGNHTYSMHTNG
ERRGSKKIKGETDEHYSKILTEDIGKLQAEMFEHTGTYPSVYTYPFGAISNASFGIIADM
GFLASLSCAEKPSTVTRGKPESLRCLGRFLRPTKISSADFFEKKINIEELFE

Enzyme Prediction     

No EC number prediction in MGYG000001271_00177.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	96	245	1.5e-25	0.9307692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03938	deacetyl_PgaB	4.18e-39	42	280	2	257	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB. Two well-characterized systems produce polysaccharide based on N-acetyl-D-glucosamine in straight chains with beta-1,6 linkages. These are encoded by the icaADBC operon in Staphylococcus species, where the system is designated polysaccharide intercellular adhesin (PIA), and the pgaABCD operon in Gram-negative bacteria such as E. coli. Both systems include a putative polysaccharide deacetylase. The PgaB protein, described here, contains an additional domain lacking from its Gram-positive counterpart IcaB (TIGR03933). Deacetylation by this protein appears necessary to allow export through the porin PgaA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
cd10969	CE4_Ecf1_like_5s	5.55e-33	65	250	1	185	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10918	CE4_NodB_like_5s_6s	5.64e-32	102	269	1	152	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10973	CE4_DAC_u4_5s	1.02e-28	101	244	1	130	Putative catalytic NodB homology domain of uncharacterized bacterial polysaccharide deacetylases which consist of a 5-stranded beta/alpha barrel. This family contains many uncharacterized bacterial polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family are predicted to contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
PRK14581	hmsF	4.89e-28	42	289	48	310	outer membrane N-deacetylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARI76505.1	2.79e-43	38	285	222	470
ASF40455.1	4.02e-42	37	258	204	430
CCG46444.1	4.02e-42	37	258	204	430
AAM25723.1	4.79e-40	7	250	5	262
AFS79569.1	1.81e-38	20	256	5	247

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4U10_A	5.72e-21	45	251	6	235	Probingthe structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans],4U10_B Probing the structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans]
4WCJ_A	6.06e-21	43	242	37	224	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
5BU6_A	6.89e-19	38	254	8	250	Structureof BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50],5BU6_B Structure of BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50]
3VUS_A	3.24e-15	44	242	9	227	Escherichiacoli PgaB N-terminal domain [Escherichia coli K-12],3VUS_B Escherichia coli PgaB N-terminal domain [Escherichia coli K-12]
4F9D_A	1.30e-14	44	242	13	231	Structureof Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12],4F9D_B Structure of Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	5.19e-14	36	230	58	249	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
P75906	7.37e-14	44	242	50	268	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=pgaB PE=1 SV=1
Q8XAR3	9.92e-14	44	242	50	268	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli O157:H7 OX=83334 GN=pgaB PE=3 SV=1
Q6GDD6	2.39e-12	61	254	75	258	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaB PE=3 SV=1
Q6G606	6.00e-12	61	254	75	258	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.935849	0.058352	0.003937	0.000283	0.000193	0.001410

TMHMM  Annotations     

start	end
13	35