CAZyme Information: MGYG000001271_01374

Basic Information

• Species: UBA644 sp002299265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; UBA644; UBA644; UBA644 sp002299265
• CAZyme ID: MGYG000001271_01374
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
723	MGYG000001271_7|CGC1	82988.88	4.7817

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001271	1995172	MAG	Italy	Europe

• Gene Location: Start: 106496; End: 108667 Strand: +

Full Sequence      

MAFENSSFIKPAEQFDPARLDYAPMFRKKFTVDTAVQFAVLTVCGLGYGYYYLNGSEMTP
DLFTAPVSNYEKTLWYNRYDVTEQIKTGENILAVICGNGWYNEGIRTAWDYDAAPWRDIP
KFILTLEINGEVAVRSDASWRYTLKSPYLYNQLRVGEHFDARLYDENWNQPDFDDSAWGY
AKEDDHPPKGIFRECLCQPIRVCGEYPPKSVKKIGEDRYLFDFGLNMSGVARLKVHQSAG
DRIVLEYAESMNPDNTIQYNDMDNPHYYPDSPFQTDEFICGGGEMTWTPKFTYHGFRYVV
VTGLKEATAETLTALFIHQDVNRISDFECSDENLNSLFRIGIQATWSNLFYMPTDCPTRE
KLGWMNDAQSSIEQMLTDFDMEKLLTKWWQDICDAMREDGMLPGIVPSSGWGYEWGNGPV
SEGTLFEIPYRIYLHTGDDTLLKKGLTYFKKYNRYLQGCKDAKGDICYGLDDWAPPDNTD
KVGAAFINKVFTIKFLRITILAQRVSGEDPAETQALLDREIQEIRNRYLDETGRCTIHKQ
TAVAMLVYNGLYENLAPLSEQLKELVEEKNFHHDCGMVGLRRLYMALNRCGLQEYAYRII
TARGFPSYVSWLEDGATALCEFWDMSVSQNHHMYSDFMSWMMKTILGIGADIAHPGFTQV
EINPYFFRELTYARGYCGTVRGRIGVAWKRTSDRIELTVEVPEGMTVTCRGQTLKSGVNV
ITA

Enzyme Prediction     

No EC number prediction in MGYG000001271_01374.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	212	708	4.4e-114	0.9900793650793651
CBM67	21	184	4.8e-30	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.24e-55	323	645	2	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.78e-38	39	202	6	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	6.54e-27	212	318	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	8.27e-09	655	708	7	60	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	2.38e-137	23	717	143	852
AHF16194.1	2.11e-131	3	706	155	856
QGA23306.1	2.19e-131	19	708	157	859
AYL96904.1	2.72e-127	23	706	158	854
AVM44977.1	2.73e-127	1	705	1	697

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	7.51e-90	22	702	175	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.48e-72	36	706	316	989	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	6.49e-52	26	688	134	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	5.49e-83	23	702	184	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	3.69e-72	27	702	174	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	1.21e-71	36	706	316	989	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	2.70e-62	27	706	178	873	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999969	0.000018	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001271_01374.