CAZyme Information: MGYG000001273_01122

Basic Information

• Species: Pauljensenia sp902373435
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp902373435
• CAZyme ID: MGYG000001273_01122
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	MGYG000001273_55|CGC1	63667.35	6.3791

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001273	2113963	MAG	Italy	Europe

• Gene Location: Start: 887; End: 2635 Strand: -

Full Sequence      

MNTANTHNDTADDEANDLLEQEPATDDEASASLEREPTTDDEAPTQPAEASSTPPVDGWT
QRLSTPAAGWVATTIATLVAALIRLPGLGNVRTLIFDETYYVKDAWSLLTLGYEGTWAKD
VDTAFANGDTSGLSAVGGYPVHPPTGKWLIAMGMKFFGQADPVGWRIAAAISGIITVFLL
CRLSQNLFRSPAITLLAGLFLATDGMAIVMSRTSILDGFLAMFALAAFLCVVKDQHMAQP
TLSAKLAEWDGLGELRQGWRSAWAHLTLRDRRSFAIGPNAGNRPWLFAAGICAGLACSVK
WSGIYVLAFLGLFVALREVTCRWSAGHPAPIRGALLADVWWAFILMVPTAILTYVASWFG
WFSHSAAHGHGRSGIAGFTGQMADLWLYHQEMWTFHNGLNTLHKYQSSPYTWLAQVRATS
FYWNNGEAVMGCRSGKCASDVVALGNPLLWWVGIGALLLVILATFYYRNWRVGIIALGYI
ALYVPWLAYAHRTIFIFYTVALAPYVALAVAWMIGLLAGWVTIDGSPEPAPASRQTLITG
WVCAALVTAAILGCALYFMPLWRGDVIDYDSWRAHMWLHSWI

Enzyme Prediction     

No EC number prediction in MGYG000001273_01122.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	76	362	1.6e-64	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	5.05e-20	71	317	25	226	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	6.03e-16	383	578	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
pfam02366	PMT	1.73e-12	77	323	4	205	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	5.95e-11	71	531	33	426	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
COG1807	ArnT	4.03e-09	75	388	12	263	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT34948.1	0.0	1	582	1	581
QGS11599.1	0.0	1	582	1	581
AKU65332.1	0.0	48	582	50	584
QQC43974.1	0.0	48	582	50	584
QQT14111.1	5.44e-132	69	580	19	545

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	1.45e-70	67	581	35	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	1.02e-65	69	581	43	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.02e-65	69	581	43	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	2.68e-51	54	581	25	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999955	0.000059	0.000009	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
66	88
162	181
188	210
215	232
285	307
340	362
443	465
470	487
494	516
536	558